KEGG   Ornithorhynchus anatinus (platypus): 100086365Help
Entry
100086365         CDS       T01045                                 

Gene name
PAICS
Definition
(RefSeq) phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00230  Purine metabolism
oaa01100  Metabolic pathways
Module
oaa_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100086365 (PAICS)
Enzymes [BR:oaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100086365 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100086365 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC
Motif
Other DBs
NCBI-GeneID: 100086365
NCBI-ProteinID: XP_001516499
Position
Un
AA seq 348 aa AA seqDB search
IKTAFTKKHGDTAFVALQCEMIPIEWVCRRVATGSFLKRNPGVQEGYRFYPPKVELFFKD
DANNDPQWSEEQLIASKLTFAGLTIGQTEVDIMSHATQAIFEILEKSWLPQDCTLVDMKI
EFGVSVSTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWV
AERVEVNVAFPSGPSCSAPSGGLREASGKKKKSQLLFSPACSVTVSKVPRSGSMSNLILL
LRAGDGVPTVFVAVAGRSNGLGPVMAGNTAYPVVNCPPLTADWGAQDVWSSLRLPSGLGC
PTILAPEGAAQFAAQVLGLNNHLVWAKLRASLLNTWIALKKADRDLRT
NT seq 1049 nt NT seq  +upstreamnt  +downstreamnt
ggatcaagacggctttcaccaaaaaacacggagacactgccttcgtcgccctccagtgtg
aaatgatcccgatcgagtgggtgtgcagaagggtagccaccggctcttttctcaaaagga
accccggcgtccaggagggttaccggttttacccaccaaaagtggaattgtttttcaagg
atgatgccaataatgacccccagtggtctgaagagcagctgattgcttccaaactgacct
ttgccgggctgacgattggccagactgaagtggacatcatgagccacgcgacccaggcga
tcttcgagatcctggagaaatcctggctgccccaggactgcacactggtggacatgaaga
ttgaatttggtgtcagcgtgtccaccaaggagatcgttctggccgatgtaatcgacaacg
attcctggaggctctggccgtcgggagacagaagccagcagaaggacaagcagtcttacc
gggacctcaaggaagtgacccccgaaggcttgcagatggtgaagaagaacttcgagtggg
tcgcggagagagtggaggtaaatgtggcttttccctccggtccgtcctgctccgcgccct
ccgggggactgagggaggcttcaggaaagaaaaaaaaatcccagctcctttttagcccgg
cctgctctgtgacggtctctaaggtcccacgttcggggtccatgtctaacctcattctcc
tcttacgtgcaggagacggggttcccaccgtgtttgtggccgtggctgggcggagcaatg
gtttgggacccgtgatggccggcaacaccgcctacccagtggtcaactgtcctccgctca
cagccgactggggggcccaggacgtctggtcttccctccggttgcccagtggtctcggtt
gcccgaccatcctcgccccagaaggggccgcccagttcgctgcccaggttttggggctga
acaaccacctggtctgggccaagctccgagccagcctgctgaacacctggatcgccctga
agaaggccgacagggacctccgcacctga

DBGET integrated database retrieval system