KEGG   Ornithorhynchus anatinus (platypus): 100092373Help
Entry
100092373         CDS       T01045                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:oaa00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:oaa00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:oaa04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 360 aa AA seqDB search
MVGFTSDLIPQLKEKCGFDTLDLVFLDHWKEQYLPDTKLLEECRLLREGSVLLADNVICP
GAPEYLAYIRSNSQYRSQFFPSHPXXXTFFFNPPHPSFSTAMLGTIGAVLGVLGATLLVL
RYLVDHHRVWALLWHVQFSEWLRDQLSGLSRPQRILHHVHRSATLGDPQSVIAAVDNYCR
HVEWAMNVGDKKGLILDKVVVETKPRIVLELGTYCGYSAIRIGRLLGPEARLITMEVNPA
YATVAKKMITFAGLEGKIEVMVGFTSDLIPQLKEKCGLDTLDLVFLDHWKEQYLPDTKLL
EECRLLREGSVLLADNVICPGAPEYLAYIRSNSQYRSQFFPSTLEYVQVADGMEKSVFLG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgggctttacctcagacctcattccccaactgaaggagaaatgtggctttgacacg
ctggacctcgtgttccttgaccactggaaagagcagtacctcccggacaccaagctactg
gaggaatgcaggctcctgcgagagggctcggtgctgctggccgacaacgtcatctgcccc
ggagcgcccgaatacctggcctacatccgcagcaactcccagtaccgcagccaattcttc
ccttcccacccnnnnnnnnnnacttttttcttcaatccaccccacccctccttctccaca
gccatgctgggcaccataggggcagtcctcggggtcctgggggccaccctgctggtcttg
cgctacttggtggaccaccatagggtgtgggcgctcctgtggcacgtccagttcagcgag
tggctccgggaccagctcagcggcctctcccggccccaacgcatcctgcaccacgtgcac
agatccgccaccctcggggacccacagtccgtgatagctgccgtcgacaactactgccgc
cacgttgagtgggccatgaatgtgggcgataagaaagggctgatcctggacaaggtggtg
gtagagacgaaaccccgcatcgtgctggagctgggcacctattgtggctactccgctatc
cgcattgggcgacttctgggccccgaggcacggctcatcaccatggaggtgaaccctgcc
tacgccaccgtcgccaagaagatgattactttcgctggattggaaggcaagatcgaggtg
atggtgggctttacctcagacctcattccccaactgaaggagaaatgtggcttggacacg
ctggacctcgtgttccttgaccactggaaagagcagtacctcccggacaccaagctactg
gaggaatgcaggctcctgcgagagggctcggtgctgctggccgacaacgtcatctgcccc
ggagcgcccgaatacctggcctacatccgcagcaactcccagtaccgcagccaattcttc
ccttccaccctcgagtacgtgcaggtggccgatggcatggagaagtccgtcttcctgggt
tga

DBGET integrated database retrieval system