KEGG   Octadecabacter antarcticus: OAN307_c47880Help
Entry
OAN307_c47880     CDS       T02538                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
oat  Octadecabacter antarcticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OAN307_c47880
Enzymes [BR:oat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     OAN307_c47880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4716748..4717614)
Genome map
AA seq 288 aa AA seqDB search
MTIWNLGSINADFVYSVPHIPVPGETLASTGRAVFLGGKGANMSVAAARAAARVAHIGAV
GADGLWAVERLMEYGVDTRHIAEIDVETAQAIIAVDANGENSIILHQGANVQIPVNVLEQ
ALNRAETGDTLVFQNETNLQLQAAELAVTMGLRVAYAAAPFDADAVMAVMAHLDFLILNE
VEAEQLKDATGKGPQDIPVKDVIVTLGANGATWFGADGPVDVPAHKVTPVDTTGAGDTFT
GYVLACLDRGQPMLQAMQTASKAAAIMVTRRGTADVIPDLADVQSFSG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctggaatctaggctctatcaacgcggattttgtctattctgttccgcatatt
cccgtccctggtgaaacgcttgccagcacgggccgtgcggtttttttgggcggcaaaggc
gcaaatatgtccgttgcagctgcgcgtgctgcggcccgagtggcccatatcggcgcagtt
ggtgcggatgggctctgggctgtagaacggctgatggaatacggcgttgatacgcgccac
atcgccgaaattgatgttgaaacggcgcaagcgattattgccgttgatgcaaatggcgaa
aacagcatcattttgcatcaaggggccaacgttcaaattcctgttaatgtgctagaacag
gctctaaatcgggcggaaactggcgataccttggtttttcagaacgagacaaatctacaa
ttacaggccgcagaactcgctgttacgatgggcctgcgcgtcgcctatgccgctgcgcca
tttgatgctgacgcggttatggcggtaatggcgcaccttgattttctgattctaaatgaa
gtcgaagccgaacaacttaaagatgctactggaaaaggcccacaagatatccctgttaaa
gacgtcattgtcacgctcggcgcaaatggtgcaacatggtttggcgctgatggcccagtc
gacgttccggcccacaaagtcacacccgttgataccactggcgcaggcgataccttcacg
ggatacgttcttgcgtgtcttgatcggggccagcctatgttgcaagccatgcagactgcg
tccaaagccgcggcaatcatggtcacgcgacggggcaccgccgacgtgatccctgatttg
gcggatgttcagtcctttagtggttga

DBGET integrated database retrieval system