KEGG   Oryza brachyantha (malo sina): 102719405Help
Entry
102719405         CDS       T02995                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102719405
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102719405
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102719405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 929 aa AA seqDB search
MVSGNMFYRRKPSWRADDLVSRSTLQLLDFDDGSPPEYAWRRKISSQANRLKEFNVTFRE
AIKMMRLGLRLWSYIREEASHGRKAPIDPFTRESDKPSASQGVPLGGMGSGSISRGFRGE
FKHWQIIPGSCEMSPVMANQFSIFITRGGNKKYSSVLAPGQHDSLKKSSDDGISSWDWKL
RGDRSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQDSSLPTSVFVYTIVNTGK
ERAKVSLVMTWANSIGGLSHHSGGHVNEPFIGENGVSGVLLHHKTANDNPPVTFAVAACE
NQNVNVTVLPAFGLSGESSITAREMWGTLIQDGCFDRDNFNAGPSMPSSLGDTVCAAVCA
STWVEPHGRCTVVFSLAWSSPKVKFKKGNAYYRRYTKFYGTSPRSAINLVQDALMKYKHW
EEEIDKWQSPILHDDRLPEWYKVTVFNELYFLVAGGTVWIDSASLVVDTEEMLNLKIPED
SDSPLHDSTHKSAVPLIGFTPHIIDDRENVGKFLYLEGIEYFMWCTYDVHFYASFALLEL
FPKIELSIQRDFATAVLREDKSRVRFLADGTWGNRKVIGAVAHDLGAHDPWHELNAYNIH
DTSRWKDLNPKFVLQVYRDFAATGDMSFGKDVWPAVCTAMEYMEQFDHDGDGMIENDGFP
DQTYDAWTVRGVSAYCGCLWLAALQAAAALARDLGHNDYAERCMVKFAKAKLVFEAKLWN
GSYFNYDSGTSYNSRSIHADQLAGQWYTASSGLPPLFDEDRIKCTLQKIFDYNVMRVKGG
RMGAVNGMHPNGKVDETCMQSREIWTGVTYSLAATMVLHGMENQAFTTAEGIFIAGWSEE
GYGYWFQTPEAWTIDGHYRSLIYMRPLAIWAMQYALSPPRTILEAPRVNTMDRTSHISPS
TLQFLQDSVRKMTPRNSCFGSSSSFSCEC
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcggcaacatgttctaccgaaggaagccctcatggcgtgccgatgatctcgtg
agcaggagcaccctgcaattgctggactttgatgatggctcaccaccagaatatgcttgg
agaaggaaaataagtagtcaggccaataggttgaaggagttcaatgttaccttcagagaa
gcaattaaaatgatgagacttggtctgcgcctttggtcatatattcgggaagaagcttct
catggaaggaaagcaccaattgatccattcacgagggagagcgacaagccttcagcctca
caaggagtacctcttggtgggatggggagtggtagcatttcaagaggcttcagaggagaa
tttaaacattggcagataattcctggttcatgtgaaatgtcaccagtgatggcaaaccaa
ttttcgatctttataactcgaggaggaaacaagaaatactcctctgttttagctcctggt
cagcatgatagtttaaagaaatctagcgatgatggtatatcatcctgggattggaaacta
agaggtgatcgttctacataccatgcgttgtttcctcgagcatggactgtctatgatggt
gaacctgatcctgaattgaaagtatcttgccgtcaaatatctccttttattccccataac
tatcaagacagcagtcttccaacatctgtttttgtttacactatagtgaataccggaaaa
gaaagggcgaaagtcagccttgtaatgacatgggcgaattctattggaggactttcccac
cattctggcggtcatgttaatgaaccatttataggagaaaatggagtttctggcgtgctt
ctacatcacaagactgccaatgataatcctcctgtcacttttgctgtcgcagcatgtgag
aaccaaaatgtaaatgttactgtgttgcctgcttttgggctttctggtgaaagttccatt
acagccagggaaatgtggggcacattgatccaggatggttgtttcgaccgagataatttc
aatgccggccctagcatgccttcttcattgggtgatacagtttgtgcagcagtttgtgca
tccacctgggttgaaccacatggaagatgtacagttgtattttccctggcctggtcatcc
ccaaaggttaaatttaagaaaggaaatgcatactacaggaggtatacaaaattttatgga
acttctccaaggtcagctataaacttggtgcaggatgccttgatgaagtataagcattgg
gaagaggagatcgataagtggcagagcccaattctccatgatgaccggcttccagaatgg
tacaaggttactgtctttaatgagctctacttcctagttgctggaggaactgtttggatt
gatagtgcatctttggtggttgacactgaagaaatgttgaacttaaagatacctgaggac
agtgattcgccgcttcatgacagcactcacaagtctgctgttccactcattggttttacc
ccacatataattgatgacagagaaaatgtagggaagtttttatacctggaaggaattgag
tacttcatgtggtgcacttacgatgtacacttctatgcctcttttgctcttctggaactg
tttcctaagattgagctgagcattcaacgtgattttgctacagctgttctgcgtgaagat
aaaagtagagtcaggtttctagctgatggtacttggggtaatcgcaaagtaattggtgct
gttgcccatgaccttggggctcatgatccttggcatgaattgaatgcttacaatatacat
gacacaagtaggtggaaagatctcaatcccaagttcgtgctacaggtctaccgggatttt
gcagcgacaggtgacatgtcatttggcaaggatgtctggcctgcagtttgtaccgctatg
gaatacatggaacagtttgaccatgatggtgatggtatgattgagaatgacggctttcct
gatcaaacttatgatgcttggacagttcgtggagttagtgcctattgtggttgcctttgg
cttgctgcccttcaagctgcagcggcactggcccgtgaccttggacacaatgattatgct
gagagatgcatggtgaaatttgcaaaagctaaacttgtatttgaagccaagttatggaat
ggttcatattttaattatgacagcggaacaagttacaacagtcgctccatccatgcagat
caactggctggacaatggtatactgcatcgtcaggtttgccgcctctatttgatgaggat
aggataaaatgcacccttcagaaaatatttgattataatgtgatgagggtaaaaggagga
cgtatgggagctgtgaacggtatgcatccgaatgggaaggtagacgagacctgcatgcag
tctagagaaatctggacaggagtaacatacagtttagctgctactatggtactccatgga
atggagaatcaagccttcactactgcagaaggtatttttattgccggatggtccgaagaa
ggctatgggtactggttccaaaccccggaagcatggacgatcgacggccactacaggtca
ctgatatacatgcggcccctcgcaatctgggcgatgcagtacgcgttgtcgccgccaaga
acgatcctcgaggcgccgagggtaaacaccatggacaggacctcccacatctcccccagc
acgctccagtttctccaggacagcgtcaggaagatgacgcccaggaacagctgcttcgga
agcagcagctcgtttagctgcgagtgctga

DBGET integrated database retrieval system