KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6737Help
Entry
OCAR_6737         CDS       T00783                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_6737
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_6737
   00640 Propanoate metabolism
    OCAR_6737
   00660 C5-Branched dibasic acid metabolism
    OCAR_6737
Enzymes [BR:oca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCAR_6737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2684698..2685825)
Genome map
AA seq 375 aa AA seqDB search
MNLEEHAAKHHVLVPTGVPTPEGRVCKTPEEAAAAVTAIGPSVIKAQVPTGKRGKSGGIK
IAKTADEAASAARDILSMSIGGHRVSQVLVEQLCPIERELYAAVLIDVASRAPLVLFSTE
GGMDIEEVAEKHPDAIRKHVVDIHKGFSAADAAAMLKGLPLGSATEAVGEVLAKLYAIFQ
DKDAELVEINPLAVLKDGRVVALDCKFVLDDSSALRQPDLAKVATPAKMTELEQRGADNG
LKFIQLDGNVGVLANGAGLTMTTMDVIDHFGGRPANFLEIGGEAYTKSEIALDLVLSNPG
VKSLVINFCGAFARTDVMAEGVVKAWETLKPKVPVFFSIHGTGEDEAVKLVRERLGIEPY
DFMEDAVKAAVEAAQ
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgaggagcatgcagccaagcatcacgtgctcgtgccgaccggcgttccgacg
cctgagggccgggtctgcaagacgccggaggaagccgcggccgcggtgacggccatcggc
ccgtcggtcatcaaggcgcaggtgccgaccggcaagcgcggcaagtccggcggcatcaag
atcgccaagacggcggatgaagcggcaagcgcggcgcgcgatatcctgtcgatgagcatc
ggcgggcatcgcgtctcgcaggtgctggtcgagcagctctgcccgatcgaacgcgaactc
tatgcagcggttctgatcgacgtcgcgagccgtgcaccgttggtgctgttttcgaccgaa
ggcggcatggatatcgaagaggtggcggagaaacaccccgacgccatccgcaagcatgtc
gtcgacatccacaagggcttcagcgctgccgatgcggcggcgatgctgaaaggcctgccg
ctcggctcggccactgaggccgttggcgaggtgctggcaaagctctacgccatcttccag
gacaaggatgcggagcttgtcgagatcaacccgctcgccgttctgaaggacgggcgcgtg
gtggcgctggactgcaaattcgtgctcgacgattcctccgcgctgcgtcagcccgatctc
gccaaggtggcaacgcccgcgaagatgaccgagcttgaacagcgcggcgccgacaacggc
ctgaagttcatccagctcgacggcaatgtcggcgtgctggcgaacggcgcgggcctcacc
atgaccaccatggatgtcatcgatcattttggcggcaggcccgccaacttcctcgagatc
ggcggcgaggcttacaccaagtcggaaatcgcgctcgatctggtgctgtccaatcccggc
gtcaaaagcctcgtcatcaatttctgcggcgcgttcgcgcgcacggatgtgatggcggaa
ggcgtcgtcaaggcctgggaaacgctgaagccgaaggtgccggtgttcttctcgatccac
ggcaccggtgaggacgaagccgtcaagctggtgcgggagcggcttggcattgaaccttat
gacttcatggaagatgccgtgaaagcggcggtcgaggcagcgcaatga

DBGET integrated database retrieval system