KEGG   Oligotropha carboxidovorans OM4: OCA4_c27950Help
Entry
OCA4_c27950       CDS       T01967                                 

Gene name
lig
Definition
ATP-dependent DNA ligase Lig (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
oco  Oligotropha carboxidovorans OM4
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:oco03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:oco03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:oco03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:oco03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2978405..2980096)
Genome map
AA seq 563 aa AA seqDB search
MNRFAHLLDRLAYEPGRNNKLRLITAYFREVPDPDRGWALAALTGALSFRHAKPGLIRDL
ITARTDPALFALSYDYVGDLSETVALMWPSVHASTNGDAKHSPTLTEIVTTLHTLGKTEI
PAQLASWLDELDETGRWALLKLVTGGLRIGVSARLAKTAAAALGDKDPHEIELIWPGLAP
PYLDLFAWLEGRAEKPINRDPAPFRPVMLAHAIEDSDFAGLDPADFIAEWKWDGIRVQAV
SGRKSEEHVLARLYSRSGEDITASFPDLVPSLRLPGAIDGELLVLREGRVQSFNVLQQRL
NRKSVTPKLMKDYPIHLRAYDLLAEGEDDLRDLPFIDRRARLERFIARLDDPRIDLSPQV
VFATWDDLTAARANPSDAGAGDDADAVEGVMLKRRDALYLPGRQRGQWWKWKHDPHVIDA
VLMYAQRGHGKRSSYYSDYTFGVWTVGEGGDELVPVGKAYFGFTDEELVQIDRFVRRNTV
EKFGPVRHVVHEPNKGLVLEVAFEGLARSPRHKSGVAMRFPRISRLRWDKPPGEADRLET
LKRLLKEDLASVVAEGLLGRRAG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgctttgcgcacctgctcgatcgcctcgcttatgagcccggacgcaacaacaag
ctgcggttgatcacagcgtattttcgtgaggtgccggaccccgatcgcggctgggcgctg
gcggcactgaccggtgcactgtcgtttcgccacgccaagccgggcctgatccgcgacctg
atcacggcgcgcaccgatcccgcgctgttcgcactatcttacgattatgtcggcgacctc
tcggaaaccgtggcgctgatgtggccttccgttcatgcctccacgaacggcgatgcgaag
cattctccgaccctcaccgaaatcgtcaccacgttgcatacgcttggcaagaccgagatt
cccgcgcagcttgcaagctggcttgacgaactcgacgagaccggacgctgggcgctcttg
aagctcgttaccggtggcttgcgcatcggcgtctccgcgcggcttgccaagaccgcggcc
gcagcgcttggtgacaaggacccgcatgagatcgaattgatatggccaggcctcgcgccg
ccttatctcgatctgttcgcctggctggaaggtcgcgctgaaaagccgatcaatcgcgat
cctgcaccatttcgcccggtgatgctggcgcatgccatcgaggatagcgattttgcggga
ctcgatccggcagatttcatcgcggaatggaagtgggacggcatccgcgtgcaggctgtc
agtggccgcaagagcgaggagcatgtcctcgcgcggctctattcgcgtagcggtgaggac
atcacggcgagctttcccgatctcgtaccgtcgctacgcctgcccggcgcaatcgatggc
gagcttctggtgctgcgtgaggggcgggtacagagcttcaacgtgctgcagcagcggctc
aaccgcaaaagcgtgacgccgaagctgatgaaagattatccgatccatctgcgtgcttac
gatctacttgccgaaggtgaggatgacctgcgcgaccttccgtttatcgatcgtcgcgca
cggctcgagaggttcattgcgcggctggatgatccgcggatcgatctgtcgccgcaggtg
gtattcgcgacatgggatgacctcaccgccgcgcgtgccaatccatcagatgcaggcgca
ggcgacgatgcggatgccgtggaaggtgtgatgctgaagcgccgtgatgcgctctatctt
cccggccggcagagagggcagtggtggaagtggaaacatgatccgcatgtgatcgacgcc
gtgctgatgtatgcccagcgtggccacggcaaacgctcctcctattattcggattacacg
tttggggtctggactgtcggtgaaggtggcgatgagcttgtgccggtgggcaaggcatat
tttggctttaccgacgaggagcttgtgcagatcgaccgctttgtccgccgcaacacggtc
gagaaattcggccccgtgcgtcatgtggtgcatgagccgaacaagggacttgtgctggag
gtggcgtttgaagggttggcacgctcaccgcgccataaatccggcgtcgcgatgcgcttt
ccgcgcatcagccggctgcgctgggataagccgccgggcgaggctgaccggctggagacg
ttgaaacgattgttgaaggaagacctcgcgtctgtggtcgccgaagggttgcttggccga
cgtgcaggatga

DBGET integrated database retrieval system