KEGG   Oryzias latipes (Japanese medaka): 101163842Help
Entry
101163842         CDS       T02443                                 

Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101163842
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101163842
   04217 Necroptosis
    101163842
   04218 Cellular senescence
    101163842
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101163842
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C2: calpain family
   101163842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
15
AA seq 704 aa AA seqDB search
MYPAGGISAAIYNDRLRSEGMGSKDHAVLFANQDFESLKRDCLESGCLFEDPCFPAEPPS
LGFKELAPHSSKTRGVEWIRPTELTSEPQFIVGGATRTDICQGALGDCWLLAAIASLTLN
ERLLHRVVPHGQSFQEDYAGIFHFQFWQFGEWVDVVIDDRLPVKDGELMFVHSAEGNEFW
SALMEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRKAPRDLHRIISKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGLKEVDYRGNMVRLIRIRNPWGQVEWTGAW
SDNSHEWNDVDPSDREDLHLKMEDGEFWMSFSDFLRQFSRLEICNLTPDALSEDALSHWN
TMKFYGTWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALMQKDRR
RYRRHGQDMHTIGFALYEIPEEYRGCHNVHLKKNFFLSHSSCARSETFINLREVSARLRL
PPGEYLVVPSTFEPSKEADFVLRVFTEKQSETEELDDEISADFGDEDEITEDDIDDSFRS
MFAQLAGEDMEISIRELKTILNRVISRHKDLKTDGFSSESCRTMVNLMDKDGSARLGLLE
FQILWNKIRKWLGIFREFDLDKSGAMSSYEMRLAVEGAGFKLNNQLNQILVARYADNEMV
DFDNFICCLVKLEAMFKYFQELDKDGSGVVEMNLTEWLYLTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtatccagctggagggatttctgctgccatttacaacgacaggcttcgctctgagggg
atgggctccaaggaccacgccgtgctcttcgccaaccaggacttcgagtccttgaagcgg
gactgtttggagtcggggtgcctgttcgaagacccctgcttccctgcagaacctccgtct
ttgggcttcaaagagctcgcaccccattcctctaagaccaggggtgtggaatggatcaga
cccacggagctgacgagtgagccccagttcatcgtgggaggagccacccgaacggacatc
tgccagggagcgctcggtgactgctggcttttagcggccatcgcctccctgaccctgaat
gagaggctccttcaccgcgttgttccacacggccaatccttccaggaggactacgctgga
atcttccactttcagttctggcagtttggcgaatgggtggatgttgtgattgacgatcga
ttgccggtgaaagacggagagctgatgtttgtgcattcagctgagggcaacgagttctgg
agcgccctcatggagaaagcgtacgccaagctgaatggttcctacgaggctctgtccgga
ggaagcaccaccgagggcttcgaggacttcacaggcggagtgtctgagatgtacgagctg
cggaaagctcccagagatctgcacaggatcatctccaaagctctggagagaggctccctc
ctgggatgctctattgatatcacgagtgcctttgacatggaggccgttacattcaagaag
ctggtgaagggacacgcctactcagtgactggactgaaggaggtcgattaccgcggcaac
atggtgcgcctcatcaggatacgtaacccctggggtcaggtggagtggaccggagcctgg
agcgacaactcccatgagtggaatgatgtcgacccgtctgaccgagaagacttacacctg
aaaatggaagatggcgagttttggatgtccttcagtgattttctgaggcagttttcccgt
ctggagatctgcaacctgactccagacgccctgagtgaagatgccctcagccactggaac
accatgaagttctacggcacgtggagacggggcagcaccgccgggggctgcaggaaccac
cccaacaccttttggatcaacccgcagtataaaatcacgctgctggaggaagatgatgac
ccagaggacgacgaggtggcgtgcagctttttagtcgccctcatgcagaaggaccgccgc
aggtatcggcgccacggtcaggacatgcacaccatcgggtttgccctctatgagattcca
gaggagtacaggggctgtcacaatgtccatttgaagaaaaacttcttcctgagtcactcc
tcatgcgctcgctcagagaccttcatcaacctgcgggaggtaagcgctcggctgcgtcta
cctcctggagagtacctcgttgtcccctccacctttgagcccagcaaagaggctgacttt
gtcctcagagtcttcactgagaagcagtcggagacagaggagctggatgatgagatttct
gctgactttggagatgaggacgaaataacggaagatgacatcgatgactcttttagatcc
atgtttgcccaactagcaggagaggacatggagatttctatccgcgagctaaagaccatt
ctcaacagagtcatctctcgtcacaaagacctgaagacggatggatttagctcagaatcc
tgtcggaccatggtcaacctaatggataaagatggcagcgcccgcttaggactcttggag
tttcagatcctctggaacaagatcaggaagtggcttggcattttccgggagtttgatctc
gacaaatcgggggccatgagctcatatgagatgcgtctggctgtggagggagcaggtttt
aaactgaataatcagctgaaccagattctggtggcccgctatgcagacaacgagatggtt
gactttgataacttcatctgctgcttggtcaagctggaagcaatgtttaagtatttccag
gagttggacaaagatggatcaggagttgttgagatgaatctcacagagtggctttacctg
accatgtgcggctga

DBGET integrated database retrieval system