KEGG   Oryzias latipes (Japanese medaka): 101163842Help
Entry
101163842         CDS       T02443                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101163842
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101163842
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101163842
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C2: calpain family
   101163842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 704 aa AA seqDB search
MYPAGGISAAIYNDRLRSEGMGSKDHAVLFANQDFESLKRDCLESGCLFEDPCFPAEPPS
LGFKELAPHSSKTRGVEWIRPTELTSEPQFIVGGATRTDICQGALGDCWLLAAIASLTLN
ERLLHRVVPHGQSFQEDYAGIFHFQFWQFGEWVDVVIDDRLPVKDGELMFVHSAEGNEFW
SALMEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRKAPRDLHRIISKALERGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGLKEVDYRGNMVRLIRIRNPWGQVEWTGAW
SDNSHEWNDVDPSDREDLHLKMEDGEFWMSFSDFLRQFSRLEICNLTPDALSEDALSHWN
TMKFYGTWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALMQKDRR
RYRRHGQDMHTIGFALYEIPEEYRGCHNVHLKKNFFLSHSSCARSETFINLREVSARLRL
PPGEYLVVPSTFEPSKEADFVLRVFTEKQSETEELDDEISADFGDEDEITEDDIDDSFRS
MFAQLAGEDMEISIRELKTILNRVISRHKDLKTDGFSSESCRTMVNLMDKDGSARLGLLE
FQILWNKIRKWLGIFREFDLDKSGAMSSYEMRLAVEGAGFKLNNQLNQILVARYADNEMV
DFDNFICCLVKLEAMFKYFQELDKDGSGVVEMNLTEWLYLTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtatccagctggagggatttctgctgccatttacaacgacaggcttcgctctgagggg
atgggctccaaggaccacgccgtgctcttcgccaaccaggacttcgagtccttgaagcgg
gactgtttggagtcggggtgcctgttcgaagacccctgcttccctgcagaacctccgtct
ttgggcttcaaagagctcgcaccccattcctctaagaccaggggtgtggaatggatcaga
cccacggagctgacgagtgagccccagttcatcgtgggaggagccacccgaacggacatc
tgccagggagcgctcggtgactgctggcttttagcggccatcgcctccctgaccctgaat
gagaggctccttcaccgcgttgttccacacggccaatccttccaggaggactacgctgga
atcttccactttcagttctggcagtttggcgaatgggtggatgttgtgattgacgatcga
ttgccggtgaaagacggagagctgatgtttgtgcattcagctgagggcaacgagttctgg
agcgccctcatggagaaagcgtacgccaagctgaatggttcctacgaggctctgtccgga
ggaagcaccaccgagggcttcgaggacttcacaggcggagtgtctgagatgtacgagctg
cggaaagctcccagagatctgcacaggatcatctccaaagctctggagagaggctccctc
ctgggatgctctattgatatcacgagtgcctttgacatggaggccgttacattcaagaag
ctggtgaagggacacgcctactcagtgactggactgaaggaggtcgattaccgcggcaac
atggtgcgcctcatcaggatacgtaacccctggggtcaggtggagtggaccggagcctgg
agcgacaactcccatgagtggaatgatgtcgacccgtctgaccgagaagacttacacctg
aaaatggaagatggcgagttttggatgtccttcagtgattttctgaggcagttttcccgt
ctggagatctgcaacctgactccagacgccctgagtgaagatgccctcagccactggaac
accatgaagttctacggcacgtggagacggggcagcaccgccgggggctgcaggaaccac
cccaacaccttttggatcaacccgcagtataaaatcacgctgctggaggaagatgatgac
ccagaggacgacgaggtggcgtgcagctttttagtcgccctcatgcagaaggaccgccgc
aggtatcggcgccacggtcaggacatgcacaccatcgggtttgccctctatgagattcca
gaggagtacaggggctgtcacaatgtccatttgaagaaaaacttcttcctgagtcactcc
tcatgcgctcgctcagagaccttcatcaacctgcgggaggtaagcgctcggctgcgtcta
cctcctggagagtacctcgttgtcccctccacctttgagcccagcaaagaggctgacttt
gtcctcagagtcttcactgagaagcagtcggagacagaggagctggatgatgagatttct
gctgactttggagatgaggacgaaataacggaagatgacatcgatgactcttttagatcc
atgtttgcccaactagcaggagaggacatggagatttctatccgcgagctaaagaccatt
ctcaacagagtcatctctcgtcacaaagacctgaagacggatggatttagctcagaatcc
tgtcggaccatggtcaacctaatggataaagatggcagcgcccgcttaggactcttggag
tttcagatcctctggaacaagatcaggaagtggcttggcattttccgggagtttgatctc
gacaaatcgggggccatgagctcatatgagatgcgtctggctgtggagggagcaggtttt
aaactgaataatcagctgaaccagattctggtggcccgctatgcagacaacgagatggtt
gactttgataacttcatctgctgcttggtcaagctggaagcaatgtttaagtatttccag
gagttggacaaagatggatcaggagttgttgagatgaatctcacagagtggctttacctg
accatgtgcggctga

DBGET integrated database retrieval system