KEGG   Olsenella uli: Olsu_1178Help
Entry
Olsu_1178         CDS       T01285                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ols  Olsenella uli
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ols00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Olsu_1178
   01230 Biosynthesis of amino acids
    Olsu_1178
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Olsu_1178
   00030 Pentose phosphate pathway
    Olsu_1178
   00051 Fructose and mannose metabolism
    Olsu_1178
   00052 Galactose metabolism
    Olsu_1178
  Energy metabolism
   00680 Methane metabolism
    Olsu_1178
Enzymes [BR:ols01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Olsu_1178
Protein phosphatases and associated proteins [BR:ols01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Olsu_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1344768..1345847
Genome map
AA seq 359 aa AA seqDB search
MLRIGLLTSGGDCQALNATMRAIVKTVLRNAGEGVGIVGFLDGYQGLIYDRYLTLTPGDF
SGILTRGGTILGTSRTPFKRLDIPEEDGIDKVSAMRATYGAHKLDCLFMLGGNGSTKTAN
RLSEEGLNVIALPKTIDNDTWGTDMTFGFPSAIDVATRCIDDIHTTASSHGRVFVIEIMG
HKVGWIPLHAGVAGGADVILIPEIPYDMGNVVRAIERRDQDGGRFAIVVVAEGAISREEA
AMKKKAYKAKVAQRVKPSVAYDIAEEIAQRTGREIRVTVPGHTQRGGAPDAADRIFATQC
GVEAALGMLEGSYGFMVAQVGGRMRRVPLSEVAGRLKYVDPQCDLVREAKMLGISFGDE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaatcggactgctcacgagcggcggcgactgccaggcactcaacgcgaccatg
cgcgccatcgtcaagaccgtcctgcggaacgcgggcgaaggcgtcggcatcgtcggcttt
ctcgacggctaccagggcctcatctacgaccgctacctgacgctcacccctggcgacttc
agcggcatcctcacgcgcggaggcaccatcctgggcaccagccgcacgcccttcaagcgc
ctcgacatccccgaggaggacggcatcgacaaggtctccgccatgagggcgacctatggg
gcgcacaagttggactgcctcttcatgctgggcggcaatggctccacgaagacggcgaac
cgcctgagcgaggagggcctcaacgtcatcgccctgcccaagacgatcgacaacgacacc
tggggcaccgacatgaccttcggcttccccagcgccatcgacgtggcgacccgctgcatc
gacgacatccacaccacggccagctcgcatggccgcgtgttcgtgatcgagatcatgggg
cacaaggtcggctggatacccctgcacgccggtgtcgcgggcggcgccgacgtcatcctc
atccccgagatcccctacgacatgggcaacgtcgtgagggcgatcgagcgccgggaccag
gacggcgggcgcttcgccatcgtcgtcgtggccgagggggccatctccagggaggaggcg
gccatgaagaagaaggcctacaaggccaaggtcgcccagcgcgtcaagccctccgtcgcc
tatgacatcgccgaggagatcgcccagcgcacgggccgcgagatccgcgtcaccgtaccc
ggccacacccagcgcggcggagcgcccgacgctgcggaccgcatcttcgcgacgcagtgc
ggcgtcgaggctgcgctcggcatgctcgagggcagctatggcttcatggtcgcccaggtg
ggcggcaggatgcgccgcgtgcccctgtccgaggtcgccggcaggctcaagtatgtagac
ccccagtgcgacctggtgcgcgaggcaaagatgctgggcatcagcttcggtgacgaatag

DBGET integrated database retrieval system