KEGG   Ostreococcus lucimarinus: OSTLU_2597Help
Entry
OSTLU_2597        CDS       T01029                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     OSTLU_2597
Protein kinases [BR:olu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   OSTLU_2597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 287 aa AA seqDB search
VNGVKYTKLECVGQGGTCKVYKVVSPKRKILALKRIRLDGKEHETVAGFIDEIKLLKTLR
GRDNIIQLVDAEVCPKEKLIFMVLEFGEIDLAHMLAKREKQRQNHGGVIDDNFLRLYFEQ
MVEAVNIIHEERIVHSDLKPANFLFVEGALKLIDFGIARAIQTEQAPDHTNIVRDHQVGT
VNYMSPEAILNGQASALGGPMKVGRASDIWSLGCILYQMVYGHTPFSKITGMIQKLHAIT
DPRHTIAFPPLPTENPALIDLMRKCLERDPKNRISVKEILTHRFLRP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggagtcaagtatacgaaactcgagtgcgtgggtcaaggtggcacgtgcaaggtt
tacaaagtcgtctctcccaagcgaaagattttagcgttgaagcgaattcgtctcgatggc
aaagagcacgaaaccgtggcgggttttattgacgaaatcaagctgctgaagacattacga
ggaagagacaacatcattcagctcgtcgatgcggaggtttgcccgaaggagaagctcata
tttatggtgcttgaatttggcgaaatcgacctcgcacacatgctcgccaagcgcgaaaag
cagcgtcaaaaccacggaggtgtgattgacgacaactttttacgtctgtactttgaacaa
atggtggaagcggtgaatatcattcacgaggagcgcatcgtgcacagtgatttgaaaccg
gcaaactttctctttgtcgagggcgcgctcaagctcatcgatttcggcatcgcgcgcgcg
atacagacggagcaagcgcccgatcacacgaatattgtgcgagatcatcaagttggaacg
gtgaactacatgtcccctgaggcaatcctgaacggacaagcgtccgcactcggaggaccg
atgaaagttggacgcgcgagcgatatttggagtctcggttgcatcttgtaccagatggtg
tacgggcacacgccgtttagcaaaatcaccgggatgattcaaaaacttcacgctattacc
gatccccggcacacgatcgcgtttccaccgttaccgacggagaatccggcgctcattgac
ttgatgcgaaagtgtctggagcgagatccgaagaaccgcatatctgtcaaggagattctc
acgcacagattcttgcgcccg

DBGET integrated database retrieval system