KEGG   Oceanithermus profundus: Ocepr_1945Help
Entry
Ocepr_1945        CDS       T01369                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
opr  Oceanithermus profundus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:opr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ocepr_1945
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ocepr_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1975601..1976509)
Genome map
AA seq 302 aa AA seqDB search
MESASVLVVGSLNMDLVVPVPRHPKPGETVVGGDLRRFPGGKGANQAVAAARLGARVRMI
GRVGADAYGAELKRGLEAEGIATEDVAELDVPTGVALISVGEDGQNAIVVSPGANARLWP
DDLSPERFAAAGVVVLQLETPLETVQRAAELGRAAGARVLLNAAPAQPLPEGLLGALGVL
VVNEFEAARVAGAREPAGPEEALALARVLARRVPVAVVTLGARGLVWAGAEGAGTLPAFE
VRAVDTTAAGDAFVGGLAAALAAGEPLVRALRFGSAAGALAATRPGAQPSLPTAEAVRSL
LS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgcgagcgtgctggtggtcggcagcctcaacatggacctggtggtgccggtg
ccgcgccaccccaaacccggggagaccgtcgtcggcggcgacctgcggcgcttccccggc
ggcaagggggccaaccaggcggtggccgcggcccggctgggggcgcgggtgcggatgatc
ggccgcgtcggggccgacgcctacggcgccgagctgaagcgcggcctggaagccgagggc
atcgcgaccgaggacgtggccgagctggacgtgcccaccggcgtggccctgatcagcgtg
ggtgaggacggccagaacgccatcgtcgtctcgcccggggccaacgcccgcctgtggccg
gatgacctcagccccgagcggttcgcggcggccggggtcgtcgtcttgcagctggaaacg
ccgctcgaaacggtccagcgggccgccgagctggggcgggcggcgggggcgcgggtgctg
ctcaacgccgcgccggcgcagccgctaccggaagggctcttgggggcgctcggcgtgctg
gtggtcaacgagttcgaggcggcccgggtggccggcgcgcgggaacccgcagggccggag
gaggcgctcgccctggcccgcgtgctggcgcgccgggttccggtcgcggtcgtcaccctg
ggcgcgcgcggcctggtctgggccggggccgagggcgcgggcaccctgccggccttcgaa
gtccgggcggtggacaccaccgccgccggcgacgccttcgtgggcgggctggcggcggcg
ctggccgccggcgaacccctggtgcgggcgctgcgcttcggcagcgccgccggggcgctc
gcggccacgcggccgggggcgcagccgtcgctgccgaccgcggaggccgttcgttcgttg
ctatcgtag

DBGET integrated database retrieval system