KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324502Help
Entry
4324502           CDS       T01015                                 

Definition
Os01g0153100
Orthology
K11252  
histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAEKAPAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKGK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggccgcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccgagaaggccccggcggggaagaagcccaaggcggagaagcgtctcccc
gccggcaagggcgagaagggcagcggcgaggggaagaaggcggggcggaagaaggggaag
aagagcgtcgagacctacaagatctacatcttcaaggtgctcaagcaggtccaccccgac
atcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcc
cgggagatccagaccgccgtccgcctcgtcctccccggcgagcttgccaagcacgccgtc
tccgagggcaccaaggccgtcaccaagttcacttcctcttag

DBGET integrated database retrieval system