KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324502Help
Entry
4324502           CDS       T01015                                 

Definition
(RefSeq) histone H2B.6
  KO
K11252  histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    4324502
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4324502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF RP-C YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 4324502
NCBI-ProteinID: XP_015621595
UniProt: Q9LGH4
Position
1
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAEKAPAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKGK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITS
REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggccgcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccgagaaggccccggcggggaagaagcccaaggcggagaagcgtctcccc
gccggcaagggcgagaagggcagcggcgaggggaagaaggcggggcggaagaaggggaag
aagagcgtcgagacctacaagatctacatcttcaaggtgctcaagcaggtccaccccgac
atcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcc
cgggagatccagaccgccgtccgcctcgtcctccccggcgagcttgccaagcacgccgtc
tccgagggcaccaaggccgtcaccaagttcacttcctcttag

DBGET integrated database retrieval system