KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349417Help
Entry
4349417           CDS       T01015                                 

Definition
Os10g0565200
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:osa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 522 aa AA seqDB search
MALTLRSSTSFLSPLDPSSKREDAPPCCVVPMPAPGSGGRLRLARAAPVEHATMEEMASP
EAATLLHHGGGGGQGQRRGKGTAVYVMLPLETVGAGGKVARARALAASLAALRSGGVEGV
MVDVWWGVVEREGPRRYDWEGYGELVRMVERAGLRLQMVMSFHQCGGNVGDSCNIPLPGW
VLEEMKSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQEIQVGLGPCGELRYPSYP
EANGTWRFPGIGEFQCYDKYMRASLQQAAAAAGHEEWGRGGPHDAGEYKQFPEETGFFRR
DGTWCTEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGTGAALSAKVAGIHWHYRTRSHAA
ELTAGYYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRDEQQPEHAGCSPEQLVRQVRSAA
RAARVGLAGENALERYDEAAFAQVVATAASAGLGAFTYLRMNKKLFDGDNWRQFVSFVRA
MADGGERAALPSCDTEQSDLYVGFLEKRAAPEAEAAAAAAVV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgacgctgcgttcatccacgtcgttcctgtcgccgctcgacccgtcctccaag
cgcgaggacgcgccgccgtgctgcgtcgtccccatgccggcgccggggagcggcggcagg
ctgcggctcgccagggcggcgccggtggagcacgcgacgatggaggagatggcgtcaccg
gaggcggcgacgctgctgcaccacgggggcgggggcgggcaggggcagcggcgggggaag
gggacggcggtgtacgtgatgctgccgctggagacggtgggggcgggggggaaggtggcg
cgggcgcgggcgctggcggcgagcctggcggcgctgcggagcggcggggtggagggggtg
atggtggacgtgtggtggggggtggtggagcgggaggggccccggcggtacgactgggag
ggctacggcgagctcgtccgcatggtggagcgcgccggcctccgcctccagatggtcatg
tccttccaccagtgcggcggcaacgtcggcgactcctgcaatatcccgttgccgggatgg
gtgttggaggagatgaagtcgaacccggacatcgtgtacacggacaggtcgggtcgtcgg
aatccggagtacatctcgctcggctgcgacacgctgccggtgctcaagggcaggacgccc
atccaggagatccaagtaggattggggccttgtggtgagctgaggtatccttcgtatcct
gaggccaatggaacatggcgtttccctggcatcggcgagttccaatgctatgacaagtac
atgagggcgtcgctgcagcaggcggcggcggcggcggggcacgaggagtgggggaggggc
gggccgcacgacgccggcgagtacaagcagttcccggaggagacggggttcttccggcga
gacggcacgtggtgcaccgagtacggcgacttcttcctcgggtggtactccgggatgctg
ctggagcacggcgaccgcgtcctggccgccgccgaggccgtcttccgcggcaccggcgcc
gcgctctcggccaaggtcgccggcatccactggcactaccggacgcggtcgcacgccgcg
gagctcacggcggggtactacaacacgcggcgccgcgacgggtacgcgcccgtcgcggcg
atgctggcgcggcgcggcgcggtgctcaacttcacgtgcatggagatgcgggacgagcag
cagccggagcacgccgggtgctcgccggagcagctggtgcggcaggtgcggtccgcggcg
cgcgcggcgcgcgtggggctcgccggcgagaacgcgctggagcggtacgacgaggcggcg
ttcgcgcaggtggtggccaccgcggcgagcgccgggctgggcgcgttcacgtacctgcgc
atgaacaagaagctgttcgacggcgacaactggcgccagttcgtgtcgttcgtcagggcc
atggccgacggcggcgagcgggcggcgctgcccagctgcgacaccgagcagtcggacctc
tacgtcgggttcctcgagaagagggcggcgccggaggccgaggcggccgccgccgccgcc
gtcgtgtag

DBGET integrated database retrieval system