KEGG   Oscillibacter valericigenes: OBV_06350Help
Entry
OBV_06350         CDS       T01636                                 

Definition
putative pyridoxal-phosphate-dependent enzyme
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ova  Oscillibacter valericigenes
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ova00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
604302..605273
Genome map
AA seq 323 aa AA seqDB search
MKNISNLPRLPLGQYPTPFYKLESVSARYGRDVYIKRDDLCGVALGGNKVRKLEFLLAQA
KIDGCDTVFTTGGPQSNHAALTAACAARLGMKAVLLLKRRGVTERRGNLILDELYGAEAD
LVDTDSYDEIYAEMRRRAAELETQGRKCCLIPLGGSTPLGAVGYVNCVREFTVQALAAGV
RVGHIVSATGSGGTTAGLLLGARLFQPGAKVTGVAVSGDPFDRMVPELVKGAAALLECAL
AENPGDFEMVENVGAGYAVPNALDTPQILALARDEGILLDPVYTGKAYSKLCRMLEADSL
SGDGAVVFVHTGGAAALFAMDLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatatcagtaatctgccccgcctgcctttgggacagtatcctacgccgttttac
aagctggaatccgtcagcgccagatacggacgggacgtttatatcaagcgggacgatctg
tgcggcgtggcgctgggcggcaacaaggtccgcaagctggaattccttctggctcaggcg
aagatcgacgggtgcgataccgtgttcaccaccggggggccgcagtccaaccatgcggcc
ctgaccgccgcctgtgcggcgcggcttggcatgaaagcggtgctgctgctgaagcgccgg
ggcgtgacggagcgccgtggcaatctgattttggatgagctgtacggcgcggaggccgat
ctggtagataccgattcctacgacgagatctatgccgagatgcgccgccgcgccgcggag
ctggagacacagggccgcaagtgctgcctgattccgctgggcgggtccacgcccctgggg
gccgtgggctatgtgaactgcgtccgggaattcacggtgcaggcattggcggccggtgtc
cgggtggggcacatcgtctccgccaccggttccggcggtaccaccgccggactattgctg
ggtgcgcggctgtttcagcccggtgcaaaggtcaccggcgtggctgtgtccggcgacccc
ttcgaccgaatggttccggagctggtcaagggggcggcggcgctgctggaatgcgccttg
gccgaaaatccgggagattttgagatggtagaaaacgtgggggcggggtatgccgttccc
aacgcgctggatacgcctcaaattctggcgctggcccgggacgagggcattttgctggac
ccggtttatacgggaaaggcctattccaagctgtgccgaatgctggaggcggactccctt
tccggcgacggcgcggtggtcttcgtacacaccgggggcgcggcggcgctgttcgctatg
gatctgggataa

DBGET integrated database retrieval system