KEGG   Prosthecochloris aestuarii: Paes_1540Help
Entry
Paes_1540         CDS       T00732                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
paa  Prosthecochloris aestuarii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Paes_1540
Enzymes [BR:paa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Paes_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1682043..1682792
Genome map
AA seq 249 aa AA seqDB search
MMKSVLVTRPKHQAASFVQELQKYGLNSVVFPTIEIRPASDWNIPDISTFSGAFFTSPNS
VRYFMERLTQEAPHELVHLKAIKVYAVGKTTARDLAAYGITTEPVPKVADAVNLMQTISP
EEINGKSFLFLKGNLSLGTIPAVISERGGSCSAVTVYENHPPDLNATEEVRQQIERGEIS
CITFTSPSTAQNFFQAMGTTVLPEGILVAAIGQTTANALEKLGVNTDIIPRYYDAPHFAE
AIAGALLKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatctgttctcgtcactcgcccgaaacatcaggcagcgtcattcgttcaggaa
ttacagaaatacggtctgaactctgttgtctttccgacaatagagatcagaccggcttct
gactggaatattccagacatctcaacctttagcggcgcatttttcacaagtcccaacagc
gtccgctattttatggagcgtcttacacaagaggctcctcatgagcttgtccatctcaag
gcgatcaaggtctacgctgtgggaaaaacgaccgcacgtgatcttgcggcctacggtata
accactgagccggtaccgaaagtcgccgatgccgtcaatctcatgcagacgatcagccct
gaagaaataaacggcaaatcttttctctttctcaaaggaaacctttcgctcggcacaatt
cctgccgtgatctcagaacgcggtggctcctgcagtgccgttaccgtgtatgaaaatcat
ccgcccgacctcaacgcgaccgaagaggtaaggcaacagattgagagaggcgaaatctcc
tgcattaccttcaccagtccatcaactgcgcaaaacttttttcaggccatgggcaccaca
gtactgcctgaaggcattcttgtcgctgcaataggacagaccaccgccaatgcgcttgaa
aagctcggtgtcaatactgacatcattccccgatactacgacgcacctcacttcgcagaa
gcaattgccggagccctccttaaagcatag

DBGET integrated database retrieval system