KEGG   Pyrococcus abyssi: PAB1475Help
Entry
PAB1475           CDS       T00024                                 

Gene name
porA
Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pab  Pyrococcus abyssi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAB1475 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAB1475 (porA)
   00020 Citrate cycle (TCA cycle)
    PAB1475 (porA)
   00620 Pyruvate metabolism
    PAB1475 (porA)
   00640 Propanoate metabolism
    PAB1475 (porA)
   00650 Butanoate metabolism
    PAB1475 (porA)
  Energy metabolism
   00680 Methane metabolism
    PAB1475 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PAB1475 (porA)
Enzymes [BR:pab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PAB1475 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320531..1321718)
Genome map
AA seq 395 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISALVGASAAGVRTFTATASQGLALMHEVLFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWIQFYAENNQEALDLILLAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPKRPITQGTLAFPAHYMEARYLVWEAMENARKVIDEAF
AEFEKKFGRKYQKIEEYRTDDAEIIFVTMGSLAGTLKDWVDKKREEGYKVGAAKMTVYRP
FPVEEIRELAKKTKVLAFIEKDISMGLYGAVFTDASAALINESEKPLMLDFIAGLGGRDV
TFNQLDEALSIAKEALEKGKVEKPIHWIGLRKELL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaggacagttatgaaggctaacgaagctgcagcctgggctgccaagcttgct
aagccaaaagtaattgcggcattcccaattactccatcaacactcgttccagaaaagatt
agtgagttcgttgcaaacggggaattggatgcagagttcataaaggtggagagcgagcac
tcagctatctcggccctagttggagcgagcgcagctggggtaagaactttcacagctact
gcctctcagggattagccttaatgcatgaggttctcttcatagccgctggaatgaggtta
cccatcgtcatggcaataggtaacagagctttaagcgctccaattaacatctggaacgac
tggcaggacacaattagtcaaagagataccggctggatccagttctacgctgaaaacaat
caggaagctttggacttaatcctgttagcttacaaagttgcggaggatgagagggttctc
ctacccgcaatggttggatttgatgcgttcatattgacacacacagttgagccagtggag
attccagatcaggaggtcgttgatgagttccttggagagtacgagccaaaacacgcttac
ctagatccaaagaggcctataacccagggaaccctagcattcccggcccactacatggag
gctagatacctagtctgggaagccatggagaacgcaaggaaggtaatcgatgaagcattc
gccgagttcgagaagaagtttgggaggaagtaccagaagattgaggagtatagaacagac
gatgccgagataatcttcgtaaccatgggttcactcgctggaacgctcaaggactgggtt
gataagaagagggaagagggatacaaggtaggagcagcgaagatgacggtttacaggcca
ttcccagttgaggagataagggagctagctaagaagacgaaggttctagcatttatagag
aaggacataagcatgggactctatggtgcagtcttcactgatgcgtctgcagccctaata
aacgagagcgagaagccactaatgctcgacttcatagccggtctcggtggaagagacgtc
acatttaaccagctcgacgaggcattgagtatagccaaggaagccttagagaagggtaag
gttgagaagccaattcactggattggattaaggaaggagctcttgtga

DBGET integrated database retrieval system