KEGG   Propionibacterium acnes KPA171202: PPA1819Help
Entry
PPA1819           CDS       T00188                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pac  Propionibacterium acnes KPA171202
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPA1819
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPA1819
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPA1819
Enzymes [BR:pac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPA1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1984010..1984534
Genome map
AA seq 174 aa AA seqDB search
MTEPSMRKAEHRHSLSRTMAALTAVACASTSLAATPGTAAATSPSQTPKAMSSTPYIFPG
NDGKAHKVAWDKHSFTIDGTRLSIWSGELHYWRLPSQQAWRDVMRKARANGFNAISLYFF
WGLHQESADGKFDFSGIKDIDTLLTIAEEEGLYVIARPGPYINAEISMGASPPP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgtccatgcgcaaagccgagcatcgccattccctatcccggacgatggcc
gcactgaccgcggtcgcctgtgcctcaacctcccttgccgccacacctggcacagctgcg
gcaacgtcaccgtcacagacaccgaaagcgatgtcatcgacgccttatatcttcccgggc
aacgacggaaaagcccacaaagtcgcttgggacaagcactcgttcaccatcgacggcacc
cggttgtcgatctggtccggggaactgcactactggcgcctcccctcccagcaagcgtgg
cgcgacgtcatgcgcaaggctcgcgcaaacggtttcaacgccatctcgttgtacttcttc
tggggcctgcaccaagaatccgctgacggcaagttcgacttctccggcattaaagacatc
gacacactgctcaccatcgccgaagaggagggtctgtacgtcatcgcccggcccggcccc
tacatcaacgccgaaatctccatgggggcctccccgccaccatga

DBGET integrated database retrieval system