KEGG   Pseudomonas aeruginosa PAO1: PA3737Help
Entry
PA3737            CDS       T00035                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pae  Pseudomonas aeruginosa PAO1
Brite
Enzymes [BR:pae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PA3737 (dsbC)
Secretion system [BR:pae02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PA3737 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PathoGenesis: 
UniProt: 
Position
complement(4189761..4190489)
Genome map
AA seq 242 aa AA seqDB search
MRVTRFLAAAALGLMSTLALADNADQNIRKTLQALQPDLPIDSIASSPLQGLYQVQLKGG
RVLYASADGQFVMQGYLYQVKDGKPVNLTEKAESQAIAKAINGVPASEMVVYPAKGQAKA
HITVFTDTTCPYCQKLHAEVPDLTEQGIEVRYMAFPRQGPQSAGDKQLQAVWCAKEPTKA
MDAMMNGKEIKSSECKNPVDKQFQMGQMVGVQGTPAIVLANGQLLPGYQPAKQLAKLALE
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccgttttctggctgctgccgccctcggcctgatgagtaccctggccctg
gcagacaatgccgatcagaacatccgcaagaccctgcaggccctgcaaccggacctgccc
atcgactccatcgccagcagcccgctgcaggggctctaccaggtgcagctgaagggcggc
cgggtgctctacgccagcgccgacggccagttcgtcatgcagggctacctctaccaggtg
aaggacggcaagccggtcaacctgaccgagaaggccgagagccaggcgatcgccaaggcg
atcaacggcgtgcccgccagcgagatggtggtgtatccggccaagggccaggccaaggcg
cacatcacggtgttcaccgataccacctgcccgtactgccagaagctgcatgccgaggtg
ccggacctgaccgagcaggggatcgaggtgcgctacatggcgttcccgcggcaggggccg
cagtcggcgggcgacaagcaactgcaggcggtctggtgtgcgaaggagccgaccaaggcg
atggacgccatgatgaacggcaaggagatcaagtcttccgagtgcaagaacccggtcgac
aagcagttccagatgggccagatggtcggggtgcagggaacgccggcgatcgtccttgcc
aacggccagttgctccccggctaccagccggccaagcagttggccaagctggcgctggag
gccaaatag

DBGET integrated database retrieval system