KEGG   Pseudomonas aeruginosa PAO1: PA5016Help
Entry
PA5016            CDS       T00035                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00010  Glycolysis / Gluconeogenesis
pae00020  Citrate cycle (TCA cycle)
pae00620  Pyruvate metabolism
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
pae01120  Microbial metabolism in diverse environments
pae01130  Biosynthesis of antibiotics
pae01200  Carbon metabolism
Module
pae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA5016 (aceF)
   00020 Citrate cycle (TCA cycle)
    PA5016 (aceF)
   00620 Pyruvate metabolism
    PA5016 (aceF)
Enzymes [BR:pae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PA5016 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-GeneID: 881297
NCBI-ProteinID: NP_253703
PathoGenesis: PA5016
UniProt: Q59638
Position
5638949..5640592
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGNGEGEVIELLVKPGDKVEADQSLLTLESDKASMEIPSPKAGVVKSIKAK
VGDTLKEGDEILELEVEGGEQPAEAKAEAAPAQPEAPKAEAPAPAPSESKPAAPAAASVQ
DIKVPDIGSAGKANVIEVMVKAGDTVEADQSLITLESDKASMEIPSPASGVVESVSIKVG
DEVGTGDLILKLKVEGAAPAAEEQPAAAPAQAAAPAAEQKPAAAAPAPAKADTPAPVGAP
SRDGAKVHAGPAVRMLAREFGVELSEVKASGPKGRILKEDVQVFVKEQLQRAKSGGAGAT
GGAGIPPIPEVDFSKFGEVEEVAMTRLMQVGAANLHRSWLNVPHVTQFDQSDITDMEAFR
VAQKAAAEKAGVKLTVLPILLKACAHLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDTP
DGLLVPVIRDVDRKSLLQLAAEAADLADKARNKKLSADAMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGELLA
DIRTLLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacccgacatcggcaacggtgagggtgaagtcatcgagctg
ctggtcaagcccggcgacaaggtcgaggccgatcagagcctgctgaccctggaatccgac
aaggccagcatggaaatccccagtcccaaggccggggtagtgaaaagcatcaaggcgaag
gtcggcgacaccttgaaagaaggtgacgaaatcctcgagctggaagtggaaggcggcgaa
cagcctgccgaagccaaggccgaggcagcgcccgcccaaccggaagcgccgaaagccgaa
gcgcctgctcccgccccgagcgagagcaagccggccgcccccgccgcggccagcgtccag
gacatcaaggtcccggacatcggctcggccggcaaggccaacgtcatcgaagtgatggtc
aaggccggcgacacggtcgaggccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggagatcccctcgccggcctccggggtggtggaaagcgtctcgatcaaggtcggt
gacgaagtcggcaccggcgacctgatcctcaagctgaaggtggaaggcgccgctccggca
gccgaagagcaaccggcagccgctccggcccaggccgcggcgcccgccgccgagcagaag
cccgccgcggcggcccctgcgccagccaaggccgataccccggctccggtcggcgcaccc
agccgcgacggcgccaaggtccacgccggcccggcggtgcgcatgctggcgcgcgagttc
ggcgtcgagctgagcgaagtgaaagccagcggtcccaagggtcgcatcctcaaggaagac
gtccaggtcttcgtcaaggagcaactgcagcgcgccaagtccggcggtgccggcgccacc
ggcggagccggcatcccgccgatcccggaagtcgacttcagcaagttcggcgaagtggaa
gaagtggcgatgacccgcctgatgcaggtcggcgccgccaacctgcatcgcagctggctg
aacgtgccgcacgtgacccagttcgaccagtcggacatcaccgacatggaagccttccgc
gttgcccagaaggccgcggcggagaaggccggggtcaagctgaccgtactgccgatcctg
ctcaaggcctgcgcccacctgctcaaggaactgccggacttcaacagttcgctggccccc
agcggcaaggcgctgatccgcaagaagtacgtacacatcggcttcgccgtggacactccg
gacggcctgctggtcccggtgatccgcgatgtcgaccggaagagcctcctgcaactggcc
gccgaggccgccgacctggccgacaaggcccgcaacaagaagctctcggccgatgccatg
cagggcgcctgcttcaccatctccagtctcggccacatcggcggcaccggcttcacgccg
atcgtcaacgcgccggaagtggcgatcctcggtgtgtccaaggcgaccatgcagccggta
tgggacggcaaggccttccagccgcgcctgatgctgccgctgtcgctgtcctacgaccat
cgcgtgatcaacggtgccgccgcggcgcgcttcaccaagcgcctgggcgagctgctggcg
gacatccgcaccctgctcctgtaa

DBGET integrated database retrieval system