KEGG   Pseudomonas aeruginosa M18: PAM18_0481Help
Entry
PAM18_0481        CDS       T01973                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:paf01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:paf00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:paf00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(534312..536489)
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVINDLAPKNKALLAKRDEL
QAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKPQAVLLKHNGLHF
EIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgacacgttctggaccggtgcggag
gccgtgatcaacgacctggcgccgaagaataaagccctgctcgccaagcgcgacgaactc
caggccaagatcgacggctggcaccaggctcgcgccggccaggcccacgacgcagctgcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaagacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaatgcgcgcttcgccctcaacgcctccaacgcccgctggggctcgctgtacgac
gcactctacggcaccgacgtgatcagcgaagaaggcggcgccgagaaaggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtcgcgctgaagaacggcagcgaaaccggcctgaagaatgctggccagttccttgcc
ttccagggcgacgccgccaagccgcaagcggtactgctcaagcacaacggcctgcacttc
gaaatccagatcgacccgagcagcccggtcggccagaccgatgccgcaggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggactcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaaaggcgacctg
gccgaggaagtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgtc
tacaccagggccgacggttccgaactgaccctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacctgatgaccaacgatgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacggtctgttcaccagcctgatcgccattcatgacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtatatcgtcaagccgaagatgcacggt
ccggaagaagccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacaccctgaaggtcggcatcatggacgaggagcgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgcgaccctgcacgccctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgacatcctgaccattccg
ctggcgccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacgtcggtctgatggaagaccgcgccaccctgcgcatctccagccaa
ctgctggccaactggctgcgtcacggcgtgatcagccaggagcaggtggtcgagagcctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccgaacttcgacgacaacgtcgcgttccaggccgccctggagctggtggtggaaggc
acccggcagccgaacggctataccgagccggtcctgcatcgccgccgccgtgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system