KEGG   Propionibacterium acnes SK137: HMPREF0675_3554Help
Entry
HMPREF0675_3554   CDS       T01215                                 

Gene name
narI
Definition
respiratory nitrate reductase, gamma subunit (EC:1.7.99.4)
Orthology
K00374  
nitrate reductase gamma subunit [EC:1.7.99.4]
Organism
pak  Propionibacterium acnes SK137
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:pak00910]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pak02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574024..574737)
Genome map
AA seq 237 aa AA seqDB search
MNTNLLVWLVLPYLSIILLIGGMIWRYRTDQFGWTSRSSQWNEPSILRWSSPLFHFGILF
VFLGHVLGLVIPQSWTSTIGITEDTYHVMATVLGSAAGLAALVGLLGLLYRRFMTKSVCL
TTTTMDIVTYVLLTLTVTLGCWATVHQQMIVGGYNYRDTIGPWFRSIALFQPRPELMATV
PLDYKLHVMAGMVLFSVWPFTRLVHVVSAPVSYPTRPYVIYRSKNGHLGSSSRHYGW
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacaaatctattggtatggctggtactgccttatctgtcgatcatcctcctcatc
ggagggatgatctggcggtaccgcactgatcagttcggatggacgagccgatcaagccag
tggaacgagccgtccatcctgcgctggtcgtcaccactgttccacttcgggatcctcttc
gtctttctgggacacgtcttgggacttgtcatcccccagtcatggacttccaccatcgga
atcaccgaggacacgtatcacgtcatggcgaccgttctggggagtgcagccgggctggcg
gccctcgtcggactcctcgggctgttgtaccgcaggttcatgacaaagtcggtgtgcctc
acgacaaccaccatggacatcgtcacctatgtgctgctcactctgacagtcacgctgggg
tgctgggccaccgtacaccagcagatgattgtcggcggctacaattaccgcgatactatc
ggtccatggttccgctccatcgcgctgtttcagcctcgaccagaactaatggccacggta
ccattagattataagctacatgttatggctgggatggtcctgttcagcgtatggccattc
actcggctggtgcacgtcgtttctgcaccagtaagctacccgacaaggccatacgtcata
tacaggtccaagaacggccatctgggatcttcatcgcgacactacggatggtga

DBGET integrated database retrieval system