KEGG   Psychrobacter arcticus: Psyc_2012Help
Entry
Psyc_2012         CDS       T00256                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
par  Psychrobacter arcticus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:par00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:par00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478326..2478892
Genome map
AA seq 188 aa AA seqDB search
MSYANTEVAQIVAISSNRCIGKDNELPWHISADLQHFKSMTTKPNDGAIQGIVIMGRKTF
ESMGSKPLPKRVSFIISTQVDYAEQKGLVGSEKAYVMHNLDDALTQAASLAHGAHLDTIW
VIGGERVFSDALMYTDRIELTHVDTEITDGDAFYPELPSEFEIAEESEQMHDDKSALDFR
FVTYKVEA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgccaacaccgaagttgcccaaatcgtggctatcagtagcaaccgctgtatc
ggtaaagataatgagctaccgtggcatatctcagcagacttgcagcatttcaaaagcatg
acaaccaaaccaaatgatggcgcgattcaaggcatcgtcattatgggtcgcaagactttt
gaatcgatgggtagcaagccgctgccaaaacgtgtgagctttatcattagtactcaggta
gattatgctgagcaaaaaggcttagtaggtagtgaaaaagcctatgtcatgcataattta
gacgacgccctgactcaagcagcaagccttgcgcatggtgcacatcttgatacgatttgg
gtgattggcggtgagcgcgtctttagcgacgctttaatgtataccgaccgcattgaactg
acccatgtagacactgaaattactgatggcgatgcgttttatcctgagctaccaagcgaa
tttgaaatcgctgaagaatctgagcagatgcatgatgacaaaagtgcattagattttaga
tttgtaacttataaagtagaagcctaa

DBGET integrated database retrieval system