KEGG   Paracoccidioides brasiliensis: PAAG_04725Help
Entry
PAAG_04725        CDS       T02230                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pbl00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 782 aa AA seqDB search
MTSSPPSLRQRAGKKPADVKEQQRASSPPPTNPAKTPASAPAQWHYRIAMVVLTLLAFAT
RFANLSHPNEVVFDEVHFGKFASYYLRRTYFFDVHPPFGKLLFALMGWLVGYDGHYLFEN
IGESYIENKVPYVALRAMPAIQGALTIPVVFLIMWESGYSLPACVLSAGLVLFDNAHVGE
DRLILLDATLVLTMTLSILCYIKFYKLRHEPFGRKWWKWLLMTGISLSCVISTKYVGAFT
FLTVGAAVLIDLWDLLDVNRRGGSLSLVEFTKHFAARAAALIIVPFFFYLFWFQVHFVIL
NRSGPGDDFMSPEFQQTLGDNAMTLKSVGIDYYDHLTLRHKGTKIYLHSHKEHYPLRYED
GRISSQGQQVTGYPYNDTNNYWEILPAAPFDANDRLGHRVKNGDIVQLHHLQTDTILLTH
DVASPYYPTNQEFTTVSRELADGNRHNDTLFEIRIENGKPGEEFKTLSSLFKLVHVPTKV
AMWTHPNPLPEWAFKQAEINGNKNIQQSTNLWFVEDIPSLSPESDRLKQEARVIKQLPFT
VKYLELQRAMFYHNNALTSSHPYASEPFQWPFLLRGVSFWTKSDTREQIYFLGNPIGWWF
ASSLLAVFAGIIGADQLSLRRGIDALEEIWGPGTRSRLYNSTGFFFLCWAAHYFPFYLMG
RQRFLHHYLPAHVASALVAGALIEFVFNIDPVTKNDDASSTNSASIAVSSAKTALSGRRV
NSLKSRLGRQSVMATWAAVIAIMSAVIYGFYFFAPFTYGRPALDVAGIQARQWLSYELHF
AK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttctcccccgagcctccggcagcgagcgggaaagaaacccgcagatgtcaaa
gagcaacaacgagcaagcagcccgccgcccacgaatccggcaaaaacgcccgcttccgca
cctgcacaatggcactacagaatcgccatggtggtcctgacgctgctggcatttgcaacg
cgctttgcgaaccttagccaccccaatgaagttgtgtttgatgaggtacactttggaaag
tttgcttcatactaccttcgacgcacctatttcttcgatgtccacccgccatttgggaag
ctcctgtttgccctcatgggctggctggtgggatacgatgggcattacctcttcgagaac
attggggagtcgtacatagaaaataaggtcccgtatgtcgctcttcgggccatgccagct
attcaaggcgctctaacgatccccgtggttttcctaatcatgtgggagtccggctattcc
ctgccagcctgcgttctatctgcagggctggtcttgttcgacaacgcgcatgttggggag
gataggctcattctgctagatgcgacgctagttctgacaatgacactgagcatcctctgt
tacatcaaattctacaaattgagacatgagccatttggccgtaagtggtggaaatggctg
ctgatgaccggaatctcgttgagctgtgtgatttcaactaaatacgttggtgcctttacc
tttttgactgttggggccgctgtcttgatagatctgtgggatttgcttgacgtgaaccgc
cgtggaggttctctgtctctggtcgaattcaccaaacacttcgccgctcgggcagcagcg
ctgatcattgtgccgtttttcttttatctgttctggttccaggttcactttgtgattctc
aacaggtccggcccaggagatgactttatgagccctgagttccagcagactcttggcgac
aatgcgatgactttgaaatcggttggaattgactactatgaccatctcaccctccgacac
aagggtaccaagatatatctgcacagccataaagaacattaccccctgcgttatgaggac
ggtcgcatttccagccaaggtcaacaagttactggttacccttacaatgataccaataat
tattgggagatccttcctgcagctccatttgatgccaacgaccgacttggacatcgcgtt
aaaaatggtgacattgtccagcttcatcatcttcaaacggatactattcttctaactcac
gacgtggcttccccatattacccaacgaaccaagaattcaccactgtctcgcgggaattg
gcagatggcaatcgccacaatgataccttgtttgagatcaggatcgagaatggaaaacct
ggcgaggaattcaaaacattgtctagtcttttcaaacttgtccatgtgcctacgaaagtt
gccatgtggactcatcccaaccccttaccggaatgggctttcaagcaggccgaaatcaac
ggaaacaaaaacatccaacagtcaactaatctatggtttgttgaggatattccatcccta
agcccggaaagcgacaggttaaagcaggaagctcgcgttatcaaacaacttccttttacc
gtaaagtacctcgagcttcagagggcaatgttctaccacaacaatgccctaactagcagc
catccctatgccagcgagccgttccaatggcccttccttctccgcggagtaagcttctgg
accaagagcgatactcgtgaacaaatatacttccttggcaatcccatcggctggtggttt
gccagcagtctccttgcggtgttcgcaggtatcatcggtgccgaccaactgtctctccga
agaggcattgacgctctggaagaaatctggggacctggcacccgctcccgcctctacaac
agcacaggcttcttctttctgtgctgggccgcacactacttcccattctatctcatgggc
cgccaacgcttcctacaccactacctacccgcccacgttgcctccgccctcgttgccggt
gccctaatcgaatttgtcttcaacatcgatccagtaactaagaatgatgacgcctcgagc
accaactcagcctcgatcgcggtgtcaagcgccaaaacggccctgtcaggtcgacgggta
aatagtctcaagtcacgactgggccggcagagtgtgatggctacatgggcggctgttatt
gctattatgagcgcggtgatctatgggttctatttctttgcgccgtttacgtatggacga
ccagctctggatgttgctggcattcaggcgaggcagtggttgtcgtatgagttgcatttt
gcgaagtaa

DBGET integrated database retrieval system