KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_06490Help
Entry
PACID_06490       CDS       T02345                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00010  Glycolysis / Gluconeogenesis
pbo00520  Amino sugar and nucleotide sugar metabolism
pbo01100  Metabolic pathways
pbo01110  Biosynthesis of secondary metabolites
pbo01120  Microbial metabolism in diverse environments
pbo01130  Biosynthesis of antibiotics
pbo01200  Carbon metabolism
Module
pbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_06490
   00520 Amino sugar and nucleotide sugar metabolism
    PACID_06490
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     PACID_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFV88488
UniProt: K7RU94
Position
complement(739143..740003)
Genome map
AA seq 286 aa AA seqDB search
MSNVLGIDIGGSGIKGAPVDLEVGEFAEPRLRIPTPSKSSPKKVAEVLRKIVKNFEPTIG
DGPVGISFPAPSRHGVIPFIANLDQGWAGLNAEEYLSEALDRPVTVVNDADAAGLGEVHY
GAAKGVPGVVILTTLGTGIGTAILNDGILLPNTELGHVEIDGYDAEKRAAASIKDKKHMS
YKYWAQKRLQKYYSFMEMLFTPDLFVVGGGVSKDHDKFFKFLKLDTPIVPATLFNRAGII
GAAFQADWRMSHPDTVTREKTKKAAKKAIAEAEKAEEKKDKEKSDK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtgctgggcatcgatatcggcggctccggaatcaaaggcgcccccgtcgac
ctcgaggtgggagagttcgcggagccgcgactccggatccccactccctccaagtcatcc
ccgaagaaggtggccgaggttctccgcaagatcgtgaagaacttcgagccgaccatcggc
gacggaccggtggggatctccttccccgccccctcgcgccacggcgtcatccccttcatc
gccaatctcgaccagggctgggcgggcctcaatgccgaggagtacctctcggaggccctc
gaccggccggtcaccgtggtgaacgacgccgacgccgccggcctgggcgaggtgcactac
ggcgccgccaagggggttcccggcgtcgtcatcctcaccactctgggcaccggcatcggc
accgcgatcctcaacgacgggatcctgctgcccaacaccgagctcggccatgtggagatc
gacggctatgacgccgagaagcgcgcggcggcgtcgatcaaggacaagaagcacatgtcc
tacaagtactgggcgcagaagcggctccagaagtactacagcttcatggagatgctcttc
acccccgacctcttcgtcgtcggcggcggcgtgagcaaggatcacgacaagttcttcaag
ttcctcaagctcgacaccccgatcgtcccggcgactctgttcaaccgtgcgggcatcatc
ggcgccgccttccaggcggactggcgcatgtcccatccggacacggtgaccagggagaag
acgaagaaggccgccaagaaggccatcgccgaggccgagaaggccgaggagaagaaggac
aaggagaagtccgacaagtag

DBGET integrated database retrieval system