KEGG   Propionibacterium acidipropionici: PACID_17950Help
Entry
PACID_17950       CDS       T02345                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PACID_17950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PACID_17950
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PACID_17950
Enzymes [BR:pbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PACID_17950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1901788..1903218)
Genome map
AA seq 476 aa AA seqDB search
MRYLSTRGLPEGPRPGFSEILLEGLAPDGGLYMPETYPQVDAATLASWRSTLAADGYAGL
AASVLSLFIDDIDAADLRRLCDEAYSDEVFSSPLIAPVDELDGGLWLAHLSGGPTAAFKD
MAMQLLGRLFEFELNRRGRELTILGATSGDTGSAAEYAMLGRRGIRVFMLTPAGRMTPFQ
QAQMFSLDDPSIVNIAVDGVFDDCQDLVKELFSDLEFRRRHHLGAVNSINWARLAAQVVY
YISSWLRATTSDDQEVSFAVPTGNFGDIMAGHVARMMGVPIRTLVLATNENNVLDEFFRT
GVYRVRGAAETLATSSPSMDISKASNFERFIFDLLGRDSARIRDLFGAQLPSQGSFDLSG
SSEFSSIPSHYGFVSGSSRHADRLATISQVLERDGVLIDPHTADAVTVARRHVEPGIPMI
VLETALPVKFAATIAEATGRVPERPSRFEGLEELPRHVIDLPDDAGALRALIAGRS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctacctctccacccgtggactgcccgagggcccccggcccggattcagcgagatc
ctgctcgagggcctggcccccgacgggggcctgtacatgcccgagacctacccgcaggtc
gatgccgccaccctggcctcgtggcgctcgacgctggccgccgacggttacgccggcctg
gcggcgtcggtgctctccctgttcatcgacgacatcgacgccgccgacctccggcggctg
tgcgacgaggcctacagcgacgaggtcttctccagcccgctgatcgccccggtcgacgag
ctggacggcgggctgtggctcgcgcacctgtccggcggccccaccgccgccttcaaggac
atggccatgcagctgctcggccgactcttcgagttcgagctgaaccgccgcggccgcgaa
ctcaccatcctcggcgccacgagcggcgacaccggatcggccgccgagtacgccatgctg
ggacgccggggcatccgggtcttcatgctcacccccgccgggcggatgacccccttccaa
caggcccagatgttcagcctcgacgacccctcgatcgtcaacatcgccgtcgacggggtc
ttcgacgactgccaggacctcgtcaaggagctcttctccgacctggagttccggcgccgc
caccacctcggcgcggtgaactcgatcaactgggcccgcctggccgcccaggtcgtctac
tacatctcctcctggctgcgggccaccacctccgacgaccaggaggtgtccttcgcggtg
cccaccggcaacttcggggacatcatggccggtcacgtagcccggatgatgggggtgccg
atccggaccctggtgctggccaccaacgagaacaacgtcctcgacgagttcttccgcacc
ggcgtctaccgggtccgcggggccgccgagaccctggccacctcctcaccctcgatggac
atctccaaggcctcgaacttcgagcggttcatcttcgacctgctgggccgcgactccgcg
cgaatccgcgacctattcggtgcacaactgccctcccagggcagcttcgacctgtccggc
tcctccgagttctcctcgatcccctcccactacgggttcgtgtccggctcctcccgccac
gccgaccggctggccaccatctcccaggtgctggagcgcgacggcgtcctgatcgacccg
cacaccgccgacgcggtgacggtggcccgccgtcacgtcgaaccggggatcccgatgatc
gttctggagaccgcgcttccggtgaaattcgcagccaccatcgccgaggccaccgggaga
gtgcccgagcgcccctcccgcttcgagggtctggaggagctcccgcgtcacgtcatcgac
ctgcccgacgacgcaggggccctgagggccctgatcgccgggcggtcgtga

DBGET integrated database retrieval system