KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_039670Help
Entry
PCC21_039670      CDS       T02320                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00860  Porphyrin and chlorophyll metabolism
pcc01100  Metabolic pathways
pcc01110  Biosynthesis of secondary metabolites
pcc01120  Microbial metabolism in diverse environments
Module
pcc_M00121  Heme biosynthesis, glutamate => heme
pcc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC21_039670
Enzymes [BR:pcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PCC21_039670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AFR05370
UniProt: J7L1Q7
Position
4495396..4496136
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPTGEQLVTRLRKLGYNAWHSPLIEFSPGRELASLPTLLQALSADDLVFALS
QHAIHYADPMLVRTGINWPAHLAYYAIGRTTALALHKISAHPVAYPPERETSETLLQLTD
LQDVSGKRALLLRGNGGRELLGETLTERGAQVTYCECYQRRDVHYDGLEQSRHWQQIGID
KLVITSGEMLQRIYTLVPDYYRASWLLGCQLIVVSERLAEQARQLGWRDIRVADNADNDA
LVRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaattctggttacccgtccgtcaccaactggcgaacaactggtgacccgtttaaga
aagctcggctataacgcctggcacagcccgctgatcgagttttcacccggacgagaactc
gccagcctgcctaccctattacaggcactgagcgccgacgatttggtgtttgcgctctca
caacacgccattcattacgccgatccgatgctggtacgtacgggcatcaactggcctgcc
catctcgcttattacgccataggccgaaccaccgcgctggcgctgcataaaatcagcgca
cacccggtagcctatccgcctgagcgcgaaaccagcgaaacgctcctgcaacttactgac
ctgcaagatgtttccggtaaacgcgcattattgctgcgcggcaacggcggcagggaactg
ctaggggaaacgctaaccgagcggggcgcacaggtgacctactgtgaatgttatcagcgc
agagacgttcactatgacgggctagagcaaagccgccactggcaacaaataggcatcgac
aaactggtgatcaccagcggagaaatgctacaacggatctatactttagtacctgattac
tatcgggcttcctggttactcggctgccagttgatcgtcgtcagcgaacggctggcagaa
caagctcgtcagcttggctggcgtgatatccgagtggctgataatgccgataacgatgcg
ctcgtgcgcgcactacaataa

DBGET integrated database retrieval system