KEGG   Pyrobaculum calidifontis: Pcal_0088Help
Entry
Pcal_0088         CDS       T00483                                 

Definition
Radical SAM domain protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pcl  Pyrobaculum calidifontis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87763..89196
Genome map
AA seq 477 aa AA seqDB search
MRFIRAASGVHVVAVMTHPMPCPGRCTFCPTARDAPKSYLSDSPVVLRAKRSGYDPYLQT
AGRVKVYLENGHVPSKVEVVVMGGTFSALPRGYREWFVANVYKALNDYPNWAAKAAESPS
LEFEQLRNEAALLRMVALAVETRPDYVDEGEVDFLLQLGVTRVELGVQSIYDDVLAKVKR
GHGAREAAEATALLKDAAYKVCYHLMPGLPGSDPDRDLEMFKTVFSDPAYMPDCVKIYPL
YVVPGTELYEQWRRGGYKSYDEETWLELLAKIYASVPRWARVMRLGRDIPLHHVVDGPRW
GNMRQVVLKKMAEVGLPCVEIRCREVGVKLANGAPVEPGPIEIKRAVYEASGGVEVFLEA
VGPDDTLYGILRLRMPHAPRRPELSRRTALVRELHVYGPAVPVGERGIWWQHMGIGRRLM
AAAEEVAREFGARKVAVISGVGAREYYRKLGYERCGPYMCKPLEKPLGHADEELITV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatttattcgggccgccagcggcgtacacgtcgtggccgtcatgacgcaccccatg
ccttgcccaggccgttgcaccttctgcccaactgccagagacgcccccaagtcctacctc
tccgacagcccagtggtgctgagggccaagaggagcggctacgacccctacctccagacc
gccggcagagtcaaagtctaccttgaaaacggccacgtgcccagcaaagtagaggtggtg
gtgatggggggcaccttctccgccctgccccgggggtacagggagtggtttgtggcaaac
gtctacaaggcgctcaacgactaccccaactgggcggccaaggccgcggagtccccctcg
ctggagtttgagcaactgcgcaacgaggccgccctcctgagaatggtggcgctagccgtg
gagactcggccggactacgtcgacgagggggaggtggacttcctcctccagctgggcgtc
accagggtggagctgggggtgcagtccatctacgacgacgtcttggctaaggtgaagagg
ggccacggggccagggaggccgcggaggccactgcccttctaaaggacgcggcgtataag
gtgtgctaccacctaatgcccggcctccccggaagcgacccagaccgggacctcgagatg
ttcaagacagtgttctccgacccggcctacatgccagactgcgtcaagatatacccccta
tacgtcgtgccggggactgagctctacgagcagtggaggcgcggcgggtacaagagctac
gacgaggagacttggctagagctcttggccaagatctacgcctctgtccccaggtgggcc
agagtcatgagactcggccgcgacatacctctacaccacgtggtagatggcccaaggtgg
ggcaacatgcggcaggtggtgttgaaaaagatggccgaggtgggcctcccctgcgtagag
attaggtgccgcgaggttggggtcaagttagccaacggggcgccggtggagcccgggcca
attgagatcaagagggcggtctacgaggcgtctggcggcgtcgaggtgtttttagaagcg
gtggggcccgacgacactctatacggcatactaaggcttaggatgccccacgcccccagg
cgcccagagctcagccgcaggacggccctagtgagagagttgcatgtgtacggcccggcg
gtgcccgtgggggagaggggaatatggtggcaacacatgggcattgggcggagactcatg
gcggcggcagaggaggtagccagagaattcggcgcgcgcaaggtggctgtcatatctggc
gtgggggcgcgggagtactacagaaagcttggctacgagaggtgtgggccctacatgtgc
aagcccctagagaagccgctggggcatgcagacgaggagctcataacggtgtag

DBGET integrated database retrieval system