KEGG   Prevotella dentalis: Prede_0600Help
Entry
Prede_0600        CDS       T02403                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdt  Prevotella dentalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Prede_0600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Prede_0600
   00030 Pentose phosphate pathway
    Prede_0600
   00051 Fructose and mannose metabolism
    Prede_0600
  Energy metabolism
   00680 Methane metabolism
    Prede_0600
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Prede_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:737926..739917
Genome map
AA seq 663 aa AA seqDB search
MKRHYDIEKDMRYLQLLANTFPTIAEASTEIINLQAILNLPKATEHFLADIHGEYEAFQH
ILKNASGNIKRKVNELFGTTLRESEKRELCTLIYYPEQKLSLVKASEEDIDDWYHITLHH
LVAVCRDVSSKYTRSKVRKSLPADFSYIIQELLHERTEDTNKTAYINVIVDTIIATGRAD
DFIIAISNVIQRLAIDRLHLLGDIYDRGPGAHRIMDMLATYHHWDITWGNHDVIWMGAAA
GNEACICSVIRLSLRYANLTTLEEGYGINLVPLATFAMDVYADDPCAEFVPKLSGGADHI
DEKTLRLTAKMHKAIAVMEFKLEAQLYAKHPNWNMQDRRLLDFIDYEKGTIRLEGKEYKL
SSCQFPTIDPQHPDVLTPEEHDLISKLHHSFTVSEKLYKHIRLMLAHGCMYGIYNDNLLF
HASVPLDGQGKLKAVETLPGHRSSGLELMTDIGQLIRTAFQSDSNPVEKDYATDYFLYLW
CGPDSPLFDKSKMATFERYFIKEKETHEEKKGNYFLFRDNEDVCDYIMDAFHVTGANRHI
INGHVPVKVGKGENPIKANGKLMVIDGGFSQAYHKETGIAGYTLVYHSRGFQLVQHEPFT
STEDAIQRGTDIKSTTQIVEMSSHRMLVADTDKGHELNAQIEDLEELLFAYRHGYINEND
GRK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaagagacactatgacattgaaaaggacatgcgctatctgcaactgcttgccaacacc
ttccctacgatagccgaagccagtaccgaaatcatcaatcttcaggccattctgaacctg
cccaaggctactgaacacttccttgccgacatccacggcgagtacgaggccttccagcac
atcctgaagaatgcctcgggcaatatcaaacgcaaggtgaacgagctcttcggcaccacc
ctgcgcgagtcggaaaagcgcgaattgtgcaccctaatctactatcccgagcagaaattg
agcctcgtcaaggcctccgaagaggacatagacgactggtatcacatcacgttgcaccat
cttgtggccgtctgccgcgacgtttccagcaagtacacacgctccaaagtgcgcaagtcg
ctgcccgccgacttctcctatatcatccaggaactgctgcacgagcgcaccgaagacacc
aacaagacggcctacatcaacgtcattgtcgacacgatcatcgccaccggacgggccgac
gacttcattattgccatttccaacgtgattcaacggctggccatcgaccggcttcacctg
cttggcgacatctacgaccgcggccccggcgcccaccgaatcatggacatgcttgccacc
tatcaccattgggacatcacgtggggcaaccacgacgtcatttggatgggggccgcagca
ggcaacgaggcctgtatttgcagcgtcatccgactgtcgctgcgctatgccaatctcact
actctcgaagagggctacggcatcaacctggtgccgctggccacctttgccatggacgtt
tacgccgacgacccctgtgcggagttcgtgcccaagctgtcgggcggggccgatcacatc
gacgagaagaccttgcggctcacggccaagatgcacaaggccatagccgtcatggagttt
aagctcgaggcgcagctctacgccaagcaccccaactggaacatgcaggaccggcggctg
ctcgatttcatcgactatgagaagggaactatccgcctcgagggcaaggagtacaagctt
tcaagctgccaattccccacgatagacccgcaacaccccgacgtgctgacgccggaggag
cacgacctcatcagcaaactgcaccacagctttaccgtgagcgagaaactgtacaagcac
atccgcctgatgctggcccacggctgcatgtacggcatctacaacgacaacctgcttttc
cacgcttccgtgccccttgacggccagggaaagttgaaagccgtcgagactttgcccggc
cacaggagcagcggactggagctgatgaccgacatcgggcagctcatccgcacggctttt
cagtcggattccaaccctgttgaaaaggattatgccacggattacttcctctatctgtgg
tgcgggcccgacagtccgctcttcgacaagtcgaagatggccacctttgaacgctacttt
atcaaggaaaaagaaacacatgaagagaagaaaggcaactacttcttgttcagagacaac
gaggatgtgtgcgactacatcatggatgcgttccacgtaaccggcgccaaccgccacatc
atcaacggccatgtgcccgtaaaggtcggcaagggagagaaccccatcaaggccaacggc
aagctgatggtcattgatggcggcttctcacaggcctatcacaaggagacgggcattgcc
ggatacacgctcgtgtaccacagtcgaggcttccaactggtgcagcacgagcctttcaca
agcaccgaagacgccatccagcggggcaccgacatcaagtcgaccacgcagattgtcgag
atgtcgtcccaccgcatgctggtggccgacaccgacaagggccacgaactcaacgcccaa
atcgaggacttggaggagttgctctttgcctatcgccacggttacatcaacgaaaacgac
ggccgcaaatag

DBGET integrated database retrieval system