KEGG   Prevotella dentalis: Prede_0600Help
Entry
Prede_0600        CDS       T02403                                 

Definition
(GenBank) hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pdt  Prevotella dentalis
Pathway
pdt00010  Glycolysis / Gluconeogenesis
pdt00030  Pentose phosphate pathway
pdt00051  Fructose and mannose metabolism
pdt00680  Methane metabolism
pdt01100  Metabolic pathways
pdt01110  Biosynthesis of secondary metabolites
pdt01120  Microbial metabolism in diverse environments
pdt01130  Biosynthesis of antibiotics
pdt01200  Carbon metabolism
Module
pdt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pdt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Prede_0600
   00030 Pentose phosphate pathway
    Prede_0600
   00051 Fructose and mannose metabolism
    Prede_0600
  Energy metabolism
   00680 Methane metabolism
    Prede_0600
Enzymes [BR:pdt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Prede_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AGB27959
UniProt: F9CZY3
Position
1:737926..739917
Genome map
AA seq 663 aa AA seqDB search
MKRHYDIEKDMRYLQLLANTFPTIAEASTEIINLQAILNLPKATEHFLADIHGEYEAFQH
ILKNASGNIKRKVNELFGTTLRESEKRELCTLIYYPEQKLSLVKASEEDIDDWYHITLHH
LVAVCRDVSSKYTRSKVRKSLPADFSYIIQELLHERTEDTNKTAYINVIVDTIIATGRAD
DFIIAISNVIQRLAIDRLHLLGDIYDRGPGAHRIMDMLATYHHWDITWGNHDVIWMGAAA
GNEACICSVIRLSLRYANLTTLEEGYGINLVPLATFAMDVYADDPCAEFVPKLSGGADHI
DEKTLRLTAKMHKAIAVMEFKLEAQLYAKHPNWNMQDRRLLDFIDYEKGTIRLEGKEYKL
SSCQFPTIDPQHPDVLTPEEHDLISKLHHSFTVSEKLYKHIRLMLAHGCMYGIYNDNLLF
HASVPLDGQGKLKAVETLPGHRSSGLELMTDIGQLIRTAFQSDSNPVEKDYATDYFLYLW
CGPDSPLFDKSKMATFERYFIKEKETHEEKKGNYFLFRDNEDVCDYIMDAFHVTGANRHI
INGHVPVKVGKGENPIKANGKLMVIDGGFSQAYHKETGIAGYTLVYHSRGFQLVQHEPFT
STEDAIQRGTDIKSTTQIVEMSSHRMLVADTDKGHELNAQIEDLEELLFAYRHGYINEND
GRK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaagagacactatgacattgaaaaggacatgcgctatctgcaactgcttgccaacacc
ttccctacgatagccgaagccagtaccgaaatcatcaatcttcaggccattctgaacctg
cccaaggctactgaacacttccttgccgacatccacggcgagtacgaggccttccagcac
atcctgaagaatgcctcgggcaatatcaaacgcaaggtgaacgagctcttcggcaccacc
ctgcgcgagtcggaaaagcgcgaattgtgcaccctaatctactatcccgagcagaaattg
agcctcgtcaaggcctccgaagaggacatagacgactggtatcacatcacgttgcaccat
cttgtggccgtctgccgcgacgtttccagcaagtacacacgctccaaagtgcgcaagtcg
ctgcccgccgacttctcctatatcatccaggaactgctgcacgagcgcaccgaagacacc
aacaagacggcctacatcaacgtcattgtcgacacgatcatcgccaccggacgggccgac
gacttcattattgccatttccaacgtgattcaacggctggccatcgaccggcttcacctg
cttggcgacatctacgaccgcggccccggcgcccaccgaatcatggacatgcttgccacc
tatcaccattgggacatcacgtggggcaaccacgacgtcatttggatgggggccgcagca
ggcaacgaggcctgtatttgcagcgtcatccgactgtcgctgcgctatgccaatctcact
actctcgaagagggctacggcatcaacctggtgccgctggccacctttgccatggacgtt
tacgccgacgacccctgtgcggagttcgtgcccaagctgtcgggcggggccgatcacatc
gacgagaagaccttgcggctcacggccaagatgcacaaggccatagccgtcatggagttt
aagctcgaggcgcagctctacgccaagcaccccaactggaacatgcaggaccggcggctg
ctcgatttcatcgactatgagaagggaactatccgcctcgagggcaaggagtacaagctt
tcaagctgccaattccccacgatagacccgcaacaccccgacgtgctgacgccggaggag
cacgacctcatcagcaaactgcaccacagctttaccgtgagcgagaaactgtacaagcac
atccgcctgatgctggcccacggctgcatgtacggcatctacaacgacaacctgcttttc
cacgcttccgtgccccttgacggccagggaaagttgaaagccgtcgagactttgcccggc
cacaggagcagcggactggagctgatgaccgacatcgggcagctcatccgcacggctttt
cagtcggattccaaccctgttgaaaaggattatgccacggattacttcctctatctgtgg
tgcgggcccgacagtccgctcttcgacaagtcgaagatggccacctttgaacgctacttt
atcaaggaaaaagaaacacatgaagagaagaaaggcaactacttcttgttcagagacaac
gaggatgtgtgcgactacatcatggatgcgttccacgtaaccggcgccaaccgccacatc
atcaacggccatgtgcccgtaaaggtcggcaagggagagaaccccatcaaggccaacggc
aagctgatggtcattgatggcggcttctcacaggcctatcacaaggagacgggcattgcc
ggatacacgctcgtgtaccacagtcgaggcttccaactggtgcagcacgagcctttcaca
agcaccgaagacgccatccagcggggcaccgacatcaagtcgaccacgcagattgtcgag
atgtcgtcccaccgcatgctggtggccgacaccgacaagggccacgaactcaacgcccaa
atcgaggacttggaggagttgctctttgcctatcgccacggttacatcaacgaaaacgac
ggccgcaaatag

DBGET integrated database retrieval system