GenomeNet

Database: Pfam
Entry: KAAG1
LinkDB: KAAG1
Original site: KAAG1 
#=GF ID   KAAG1
#=GF AC   PF15354.2
#=GF DE   Kidney-associated antigen 1
#=GF AU   Coggill P
#=GF SE   Jackhmmer:Q9UBP8
#=GF GA   27.00 27.00;
#=GF TC   98.60 98.50;
#=GF NC   25.00 19.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10601354
#=GF RT   A new antigen recognized by cytolytic T lymphocytes on a human
#=GF RT   kidney tumor results from reverse strand transcription.
#=GF RA   Van Den Eynde BJ, Gaugler B, Probst-Kepper M, Michaux L, Devuyst
#=GF RA   O, Lorge F, Weynants P, Boon T;
#=GF RL   J Exp Med. 1999;190:1793-1800.
#=GF DR   INTERPRO; IPR029407;
#=GF CC   KAAG1, kidney-associated antigen 1, or RU2AS (RU2 antisense gene
#=GF CC   protein) has been found in mammals. It is expressed in testis
#=GF CC   and kidney, and, at lower levels, in urinary bladder and liver.
#=GF CC   It is expressed by a high proportion of tumours of various
#=GF CC   histologic origin, including melanomas, sarcomas and colorectal
#=GF CC   carcinomas.
#=GF SQ   9
#=GS F7DG90_MACMU/1-84  AC F7DG90.1
#=GS H2QSD4_PANTR/1-84  AC H2QSD4.1
#=GS H2PI23_PONAB/1-84  AC H2PI23.1
#=GS G7P4J2_MACFA/1-84  AC G7P4J2.1
#=GS KAAG1_HUMAN/1-84   AC Q9UBP8.1
#=GS L8I627_9CETA/1-80  AC L8I627.1
#=GS G1SAM1_NOMLE/1-84  AC G1SAM1.1
#=GS G3T1J2_LOXAF/1-83  AC G3T1J2.1
#=GS F7IKT1_CALJA/1-81  AC F7IKT1.1
F7DG90_MACMU/1-84             .MDDDAAPREEGVPVAVHKHALHDGLRQVAGPGAAATHLPRWPQPQLAAPRREAPPLPQRPHSTQGAGSPPETNEKLTNPQVK--rs
H2QSD4_PANTR/1-84             .MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK..
H2PI23_PONAB/1-84             .MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREATPLSQRPHRTQGAGSPPETNEKLTNPQVKEK..
G7P4J2_MACFA/1-84             .MDDDAAPREEGVPVAVHKHALHDGLRQVAGPGAAATHLPRWPQPQLAAPRREAPPLPQRPHSTQGAGSPPETNEKLTNPQVK--rs
KAAG1_HUMAN/1-84              .MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK..
L8I627_9CETA/1-80             v-EDDTAAREEGVPVAVHQHALHDRLRQVPGPGTGATHLPLGTPARLASPGGGTAAAPAASQHTRGAGSRPETNAKQTSPR----..
G1SAM1_NOMLE/1-84             .MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK..
G3T1J2_LOXAF/1-83             .MDDDAAPCEEGVPVAVHQHALHYRLRQVVGPGAGAVHLPRGTPRRLAAP-GVAPLLSQLPHRTHGAGSSPETNGQETNPKVREK..
F7IKT1_CALJA/1-81             .MDDDAAPREVGVPVAVHQHALHHGLRQVAGPGAAAAHLPRSPPP--AARRGEAPPLPRRSRRTQGAGSPPETNEKLTNPQVK--k.
#=GC seq_cons                 .MDDDAAPR.EGVPVAVHKHALHDGLRQVAGPGAAAsHLPRWPPPQLAAsRREAPPLsQRPHRTQGAGSPPETNEKLTNPQVK....
//
DBGET integrated database retrieval system