KEGG   Pseudomonas fluorescens A506: PflA506_0450Help
Entry
PflA506_0450      CDS       T02114                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfc  Pseudomonas fluorescens A506
Pathway
pfc00010  Glycolysis / Gluconeogenesis
pfc00020  Citrate cycle (TCA cycle)
pfc00620  Pyruvate metabolism
pfc01100  Metabolic pathways
pfc01110  Biosynthesis of secondary metabolites
pfc01120  Microbial metabolism in diverse environments
pfc01130  Biosynthesis of antibiotics
pfc01200  Carbon metabolism
Module
pfc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PflA506_0450 (aceF)
   00020 Citrate cycle (TCA cycle)
    PflA506_0450 (aceF)
   00620 Pyruvate metabolism
    PflA506_0450 (aceF)
Enzymes [BR:pfc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PflA506_0450 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C NQRA HlyD_3 Rib_recp_KP_reg CAT
Motif
Other DBs
NCBI-ProteinID: AFJ55234
Position
complement(518349..519995)
Genome map
AA seq 548 aa AA seqDB search
MSELIRVPDIGSGEGEVIELFVKVGDTVEADQSILTLESDKASMEIPAPKAGVVKSLKVK
LGDRLKEGDELLELEIEGAADAAPAAAAPAAAAPAPAAEKPAAAEAAPAPAAAPAAATVQ
DIHVPDIGSSGKAKIIELLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE
DEVGTGDFILKLKVQGAAPAAAPAPAAAPAAKAEAAPAAAAPAPAAKAEAAPAPAAAAPA
PSGAKVHAGPAVRQLAREFGVELSAVAASGPHGRVLKEDVQVYVKTMMQKAKEAPAAGGA
TGGSGIPPIRTVDFSRFGETEEVPMTRLMQIGAAGLHASWLNIPHVTQFDQADITDLEAF
RVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKAIIRKKYVHIGFAVDT
PDGLLVPVIKNVDQKSLLQLAGEAAALAAKARDKKLTPDDMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLL
NDIRTILL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaagtaatcgagctg
tttgtgaaggtcggcgacaccgtcgaagccgaccagagcatcctgaccctggagtcggac
aaagcgagcatggaaatccctgctcccaaggccggcgtggtcaagagcctgaaagtgaag
ctgggcgaccgcctgaaagaaggcgacgaactgctggaactggaaatcgaaggcgctgct
gatgcagcccctgcggccgcggctccggccgccgctgcacctgcacctgctgctgaaaag
cctgccgctgccgaggctgctccagccccggccgccgcacctgccgccgcgaccgtccag
gacattcacgtcccggacatcggctcgtcgggcaaggccaagatcatcgagctgctggtc
aaggtcggcgacaccgtcgaagccgaccagtcgctgatcaccctggagtccgacaaggcc
tccatggagatcccatcgccggctgccggcgtagtggaaagcatcgcggtcaagctggaa
gacgaagtcggcaccggtgacttcatcctcaagctcaaagtacaaggtgctgcgccagcc
gccgcaccagcaccggctgctgctccggcggccaaggctgaagcggcacctgccgctgct
gcccctgcgccggccgcaaaagccgaagctgcgccagcccctgcggcggctgcacctgcg
ccaagcggtgccaaggttcacgccggcccagccgtgcgtcagttggcccgtgaattcggc
gtcgagctgagcgctgttgcagccagcggcccgcacggccgtgtgctgaaggaagacgtg
caggtttacgtcaaaaccatgatgcaaaaagccaaggaagctccggctgccggcggcgct
accggtggttcgggcattccgccgatccgcaccgtggacttcagccgcttcggcgaaacc
gaagaagtgccgatgacccgcctgatgcaaatcggcgcggcaggcctgcatgccagctgg
ttgaacatcccgcacgtgacccaattcgaccaggccgatatcaccgacctggaagcgttc
cgcgttgcgcagaaagccgtggccgagaaggccggcgtgaagctgaccgtactgccactg
ctgctcaaggcctgtgcacacctgctcaaggaactgccggacttcaacagctcgctggcg
ccaagcggcaaggcgatcattcgcaagaagtacgtgcacatcggctttgcggtcgacacc
ccggatggcctgctggtaccggtcatcaagaacgtcgaccagaagagcctgctgcagctc
gctggcgaagcggctgcgctggctgccaaggcccgcgacaagaagctcaccccggacgac
atgcagggcgcctgcttcaccatctccagcctcggccacattggcggtactggcttcacg
ccaatcgtcaacgcgccggaagtggcgatcctgggtgtgtccaaggccaccatccagcct
gtgtgggacggtaaagcgttccaacccaagctgatgctgccactgtcgctgtcctacgat
caccgcgtgatcaacggcgccgcggctgcgcgcttcacccagcgcctgagccagttgctg
aacgacatccgcaccatcctgctgtaa

DBGET integrated database retrieval system