KEGG   Plasmodium falciparum HB3: PFHG_04811Help
Entry
PFHG_04811        CDS       T01052                                 

Definition
conserved hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pfh  Plasmodium falciparum HB3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PFHG_04811
Enzymes [BR:pfh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PFHG_04811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 503 aa AA seqDB search
MSEYKKYNVPSHEIYDVILIGGGLFNCCLYYYLKLKNSELSIIIVEKEENLGGYIKTYTY
NIDDKKILVELGPNMFKLCNGKISAVSFFSRNLKLFHNKVNSLYIWNEKIKSEEKNRNIK
CVNNNTFIYQHMNKKKKNFNLFTPCYNFFYISNKNMKMDVYLNVLYNYYSSNKKTEKKNV
FNYICYRIPILLLHMKQFSINIFRHISIFLKCTYQFFYPFLMLPDLAKWTTSHFDDEKKK
KKNLIGKTVTFKNGLYELIDKLQSHMNKEFIYTNHEVDFIEKAYNNLWMCNIKHENQNKT
IYGKNIVLAVNSKICSNIMRNILPVNIRDILLNFSYSSIISISLYFKKSDINIPKNFFGF
LSSDKCAHILGCFHINNMFKERCHDDNKVLLTLYMGGSNHPNDITLDEYEIKEIISNDLK
NIFDIYNDAQPNILKIHKWKDAIPFYSYNYEKLLKKVMEELNKLSYKNLYLDSGWITGTS
ISDRIRSAQDLCEYIFSLTNLAS
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatataaaaaatataatgtaccttcacatgaaatttatgatgttattttaatt
ggtggtggcttatttaattgctgcctgtactattatttaaaattaaaaaattctgaactg
tctataataatagtagaaaaagaagaaaacttaggagggtatataaagacatatacatat
aatattgatgataaaaaaatattagtagagttaggtccgaatatgtttaaattatgtaat
gagagttataatttaattaataaacttaatttactttctagggttagattattagacgat
acacttataagatatatatatataaaaaatgataaatttatatccgttgtatttaaatat
attttcttatttatctttccctttaataaatatttcaaataaaattaaattactcttcaa
attaatctttaacaatataaaaatttaaattcatatacaaacgatatatctgtggaaaat
tatatgaacgataatttcgattcacaacattataattttttacttttaccttttatatat
ggctcgtgtgcaggtaatggcaaaatatctgcagtctccttcttctcaagaaatttaaag
ctttttcataataaagtgaactctttatatatatggaatgagaaaattaaaagcgaagaa
aaaaataggaatataaaatgtgttaataataatacttttatttatcaacatatgaataaa
aaaaaaaaaaattttaatttatttacaccatgttataattttttttacatttcaaataaa
aacatgaaaatggatgtatatttaaatgtcttatacaattactattcctcaaataagaag
acagaaaaaaaaaatgtatttaattatatttgttacaggattcctattttgttattacat
atgaaacaattttctattaatatatttcgtcatatttctatatttctaaaatgtacatac
caattcttttacccttttttaatgttacctgatctagccaaatggacgactagccatttt
gatgatgaaaaaaaaaaaaaaaaaaatttaattggaaaaactgttacctttaaaaatggt
ttatatgaattaatagataaattacagagtcatatgaataaagaatttatatatacaaat
catgaagtcgattttattgaaaaggcttataacaatttatggatgtgtaacatcaaacat
gaaaatcaaaataaaacaatatatggtaaaaacattgttttagctgtaaattcgaaaata
tgttctaatattatgaggaacattttaccggttaacataagagatatacttttaaatttt
tcgtattctagtattataagtatatcattatattttaagaaaagtgatataaatattcca
aaaaacttttttggatttttatcatctgataaatgtgcacatatcttgggatgttttcat
ataaataatatgtttaaagaaagatgtcatgatgataataaagtattattaactttatat
atgggtggatcaaatcatccaaatgatattactttagatgaatatgaaattaaagaaata
atttcaaacgatttaaaaaacatatttgatatatataatgatgcacaacctaatatttta
aaaatacacaaatggaaagacgcaataccattttattcatataattatgagaaactctta
aaaaaagttatggaggaattaaataaattgtcttataaaaatttgtacctcgattctgga
tggataactggaacgtcaatatcggatagaataagatctgcacaggatttgtgcgaatat
atcttttctctgacgaatcttgcatcataa

DBGET integrated database retrieval system