KEGG   Pyrococcus furiosus DSM 3638: PF1607Help
Entry
PF1607            CDS       T00075                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pfu  Pyrococcus furiosus DSM 3638
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PF1607
Enzymes [BR:pfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PF1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1497925..1499436
Genome map
AA seq 503 aa AA seqDB search
MRGKIKILDIETGNLAIFINPEDAEQWRIHPNDLVKIESGKRYIYGSAFIGNIVEKGEIG
ISKDVLSIHQFSNGEIVSLSPAGTPESVKYIKKKMRGEKLKKVEIETIVRDIVDRKLRNT
EISAFVSAIEINGLDMEEIAALTIAMAETGDMLDIERKPIMDIHSIGGVPGNKTNVIVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVTLTLEEIKRIVEKIGACLVWGGALNLA
PADDLMIHVERRLSLDPRGLMLASIMAKKYAIGSQYILIDIPTGKGAKVESMEEARSLAR
DFIELGKRLGQYVEVAITYGGQPIGYTVGPALEAKEALETLMTGRGPGSLVEKAIGLAGL
LLEMGGAAPKGKGKIIAREILEKGKAYQKMREIIEEQGGDPDIKPEDIPIGDKTYTIHAQ
TNGYVTAIDNRGITAIAREAGAPEDKGAGIRLHVKVGDKVKEGDPLFTIHAESESRLDKA
IVLARRLEPIKIEGMVLQVIENL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaaaaattaaaattttagatatagaaacaggaaatcttgccatttttataaat
ccagaagacgcagaacaatggcgaatccatccaaacgaccttgtaaaaattgaaagcggg
aagagatacatttatggaagtgcttttataggaaacattgttgaaaagggagaaattgga
atatcaaaggatgttctctcaattcatcagttttcaaatggagaaattgtttctttaagc
cctgcaggaactcctgaaagtgttaagtatataaagaaaaagatgagaggagagaaactg
aaaaaggtagaaattgagacaattgtaagagatatcgtcgatagaaagcttagaaatacc
gaaatcagcgcgtttgttagtgcaatagaaataaatggtcttgacatggaggaaattgcc
gctttaacaattgcaatggcagaaactggagatatgttggacatagaaaggaagccaata
atggatatccacagcattggcggcgtacctggaaataagaccaatgttatagttgtcccc
atagtggcggctgcaggcctaacaattcccaagacgagttcaagagcaattacaagtgca
gcaggaacagccgatgtggtggaagttttaacaaacgttacactgactcttgaagaaata
aagagaatagtggaaaaaattggagcctgcctagtttggggaggtgccctaaatttagcc
ccagcagatgacttgatgatacacgtagaaaggaggctaagtttggatccaaggggactt
atgcttgcaagtataatggctaagaaatatgctatcggaagtcaatacatactcattgac
atccccacaggaaaaggagccaaagttgagagcatggaggaggctagatcacttgcaaga
gatttcatagagttagggaagagattaggacaatacgttgaagtagcaattacttacgga
ggccagcccataggttatacagttggtccggctctagaagctaaagaagccctcgaaaca
ctaatgacaggtagagggcctggaagcttagtagaaaaggccataggactcgctgggcta
cttttggaaatgggtggagctgctccaaaaggaaagggaaaaatcattgcgagggaaatt
ctagagaaaggaaaagcatatcaaaagatgagagagattatagaagaacaaggtggagat
cctgacataaagccagaagacattccaataggagataaaacatatacaattcacgcccag
acgaatggttatgtcaccgcaatcgacaacagagggattactgcaatagcgagagaagct
ggggccccagaagataaaggggctggaattagacttcacgtaaaagtgggagacaaggta
aaagaaggcgatccactattcacaatacatgcagaaagtgaaagtaggctagacaaagct
atcgtgcttgcaagaaggcttgaacccataaagatagagggaatggttttgcaggttatt
gaaaacctctaa

DBGET integrated database retrieval system