KEGG   Pyrococcus furiosus DSM 3638: PF1607Help
Entry
PF1607            CDS       T00075                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
pfu  Pyrococcus furiosus DSM 3638
Brite
Enzymes [BR:pfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     PF1607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_transf_3 Glycos_trans_3N DUF2254 Biotin_lipoyl_2 Biotin_lipoyl Molydop_binding CDC48_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AAL81731
UniProt: Q8U0I2
Position
1497925..1499436
Genome map
AA seq 503 aa AA seqDB search
MRGKIKILDIETGNLAIFINPEDAEQWRIHPNDLVKIESGKRYIYGSAFIGNIVEKGEIG
ISKDVLSIHQFSNGEIVSLSPAGTPESVKYIKKKMRGEKLKKVEIETIVRDIVDRKLRNT
EISAFVSAIEINGLDMEEIAALTIAMAETGDMLDIERKPIMDIHSIGGVPGNKTNVIVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVTLTLEEIKRIVEKIGACLVWGGALNLA
PADDLMIHVERRLSLDPRGLMLASIMAKKYAIGSQYILIDIPTGKGAKVESMEEARSLAR
DFIELGKRLGQYVEVAITYGGQPIGYTVGPALEAKEALETLMTGRGPGSLVEKAIGLAGL
LLEMGGAAPKGKGKIIAREILEKGKAYQKMREIIEEQGGDPDIKPEDIPIGDKTYTIHAQ
TNGYVTAIDNRGITAIAREAGAPEDKGAGIRLHVKVGDKVKEGDPLFTIHAESESRLDKA
IVLARRLEPIKIEGMVLQVIENL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaaaaattaaaattttagatatagaaacaggaaatcttgccatttttataaat
ccagaagacgcagaacaatggcgaatccatccaaacgaccttgtaaaaattgaaagcggg
aagagatacatttatggaagtgcttttataggaaacattgttgaaaagggagaaattgga
atatcaaaggatgttctctcaattcatcagttttcaaatggagaaattgtttctttaagc
cctgcaggaactcctgaaagtgttaagtatataaagaaaaagatgagaggagagaaactg
aaaaaggtagaaattgagacaattgtaagagatatcgtcgatagaaagcttagaaatacc
gaaatcagcgcgtttgttagtgcaatagaaataaatggtcttgacatggaggaaattgcc
gctttaacaattgcaatggcagaaactggagatatgttggacatagaaaggaagccaata
atggatatccacagcattggcggcgtacctggaaataagaccaatgttatagttgtcccc
atagtggcggctgcaggcctaacaattcccaagacgagttcaagagcaattacaagtgca
gcaggaacagccgatgtggtggaagttttaacaaacgttacactgactcttgaagaaata
aagagaatagtggaaaaaattggagcctgcctagtttggggaggtgccctaaatttagcc
ccagcagatgacttgatgatacacgtagaaaggaggctaagtttggatccaaggggactt
atgcttgcaagtataatggctaagaaatatgctatcggaagtcaatacatactcattgac
atccccacaggaaaaggagccaaagttgagagcatggaggaggctagatcacttgcaaga
gatttcatagagttagggaagagattaggacaatacgttgaagtagcaattacttacgga
ggccagcccataggttatacagttggtccggctctagaagctaaagaagccctcgaaaca
ctaatgacaggtagagggcctggaagcttagtagaaaaggccataggactcgctgggcta
cttttggaaatgggtggagctgctccaaaaggaaagggaaaaatcattgcgagggaaatt
ctagagaaaggaaaagcatatcaaaagatgagagagattatagaagaacaaggtggagat
cctgacataaagccagaagacattccaataggagataaaacatatacaattcacgcccag
acgaatggttatgtcaccgcaatcgacaacagagggattactgcaatagcgagagaagct
ggggccccagaagataaaggggctggaattagacttcacgtaaaagtgggagacaaggta
aaagaaggcgatccactattcacaatacatgcagaaagtgaaagtaggctagacaaagct
atcgtgcttgcaagaaggcttgaacccataaagatagagggaatggttttgcaggttatt
gaaaacctctaa

DBGET integrated database retrieval system