KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c02920Help
Entry
PGA2_c02920       CDS       T02193                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pgl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
324177..325013
Genome map
AA seq 278 aa AA seqDB search
MTVEAFAPAKINLTLHVTGQRADGYHLLDSLVVFADIGDRITVAVADERSLQVTGSMAAG
VPVDDSNLMMQAAALMDPARGAALSLEKNLPPASGIGGGSSDAAATLRALSGLWGLPLPG
TQDVLLLGADVPVCMSPSTQRMRGIGERLDGLPPLPDCAIVLINPGVSVATPAIFRAMGK
RDNPAMPAELPTWDSVDDLAAWLKTQRNDLQPPAIRLEPVIGTVLEALSGTDPLYHAMSG
SGATCYGLYSTDAEAQAAAGQLRAAHADWWVRAGRLLA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgaggcatttgcccctgccaagatcaatctgaccctgcatgtgaccggccag
cgcgcggatggctatcatcttcttgattcgctggtggtttttgccgatatcggagaccgg
atcacggttgctgtggcggatgagcgatcgctgcaggtgactgggtcgatggcagcaggc
gtgccggtggatgacagcaatctgatgatgcaagccgcagcgctgatggatcctgcgcgc
ggggctgcgctgtcactggagaaaaacctgccgcctgcgtcggggatcggaggggggtcc
tctgatgcggcggcgactctccgggcgttgtctggattgtgggggctacccctgccgggc
acgcaggatgtgcttctgctaggggccgatgtgccggtctgtatgtcgccgagcacacag
cggatgcgtggaataggggagcgcctggacggtttgccaccgttgccagactgcgcgatt
gtgctcataaacccgggcgtgtccgtggccacgcccgcgatttttcgcgccatgggcaaa
cgggacaatccggccatgcctgccgagcttcctacctgggactctgttgacgatctggca
gcatggcttaagactcagcgcaacgatctgcagccgccagctatccggttggaacctgtg
atcggaacggttctggaggcattgtctgggacggaccccctgtatcacgcgatgtccgga
tcgggcgcgacctgctatggtctctactcaacagatgcagaagcacaggccgccgcaggc
cagctgcgggcggcacatgctgactggtgggtgcgcgcggggcgtctgctggcctga

DBGET integrated database retrieval system