KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c33700Help
Entry
PGA2_c33700       CDS       T02193                                 

Definition
uoporphyrinogen-III synthase HemD-like protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGA2_c33700
Enzymes [BR:pgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PGA2_c33700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3657259..3658026
Genome map
AA seq 255 aa AA seqDB search
MTVANNPEGRVMVGLLMTRPRVVAERFVEDLPASTRATLQVIYAPLIRTTPLNPPSDPSE
RGLFSGDAIFSSANGVRYSTAPVAGQDAYCVGQRTTQAAAAKGWRAICCGLDADALVQTL
TEVPPAGPLTHLRGVHSRGDIVERLRLVGINCREHVIYDQILLPYDSEARIAMDAQASLI
VPLFSPRTAQQFVKLAPYCAELHLIAFSKAVADPLKGLKCKDLQICKSPTATAMRTLVRD
AAASLARVEGGPSAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgaacaatcccgaggggcgtgtgatggtcggcctattgatgacacgccct
cgtgtggtggcagagcgatttgtcgaagacttgcccgcatcgacccgagcgaccttgcag
gtgatctatgccccgttaatcaggacaaccccgctgaacccgccatctgatccttccgaa
cgtgggcttttttcgggggatgcgatcttctcatctgcgaatggggtgcggtattcgact
gcgccggttgcggggcaggacgcttattgcgtcgggcagcgcacaacgcaggccgcagct
gcgaaagggtggcgggcgatttgctgtggtctggacgctgacgcgctggttcagaccttg
accgaggtcccacctgcaggtcctttgacccatctgcgcggcgtccatagccgcggcgac
attgtcgagcggcttcgcttggtagggatcaattgccgggaacatgtgatctatgatcag
atcttgctgccttatgatagtgaggcgcggatcgcgatggatgcgcaagcgtcgctgatc
gtgccgcttttctcaccgcgtaccgctcagcaatttgtcaaattggcgccatattgcgca
gagctacatctgatcgcattcagcaaggcggttgcagatcctctgaaaggcttgaaatgc
aaagacttacagatatgtaagtctccaaccgcgacggcaatgcgtacactggtgcgtgat
gccgcagctagtctggcgcgggttgagggtgggccatcggcacagtaa

DBGET integrated database retrieval system