KEGG   Puccinia graminis: PGTG_15095Help
Entry
PGTG_15095        CDS       T02226                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pgr  Puccinia graminis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PGTG_15095
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PGTG_15095
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PGTG_15095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 181 aa AA seqDB search
MRAYIYDEESQLSPQDEHESSQSVSKQELEKLGVLYWSIDSIDQVNSIAIQRDYKNRDQI
ICSPQAMGDIYQQKLDTFFEEHLHEDEEIRWVVEGSGYFDVRDQTDQRWVRIKVEKGDLL
VLPPGIFHRFTVDKDNYIKAMRLFKDEPKWVALNRSTESESNPYRKAYIEQVGKAMTMGA
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctacatttacgacgaggagtcacaactttcaccccaagacgagcacgaatcg
agccagtccgtttcaaaacaagaattggaaaaacttggtgtgctttactggtcgattgac
tctatcgatcaagtcaattcaatcgcgattcaacgggattataaaaatcgtgaccagata
atttgcagtccccaagcaatgggagatatctatcaacagaaattggacaccttctttgag
gaacatcttcatgaagatgaagaaatcagatgggtagttgagggcagtggctattttgat
gtcagagatcaaaccgatcaacgttgggtacggatcaaggtcgaaaaaggtgatcttctg
gttcttcctccagggatcttccatcgatttacagtggataaggataattacatcaaagcg
atgaggctatttaaagatgaacccaaatgggtagcactcaatcggtctacggagagcgaa
agcaatccgtatcgaaaggcctatattgagcaagtcggcaaagctatgaccatgggtgcc
ttttga

DBGET integrated database retrieval system