KEGG   Meyerozyma guilliermondii: PGUG_02970Help
Entry
PGUG_02970        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
pgu  Meyerozyma guilliermondii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGUG_02970
Translation factors [BR:pgu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PGUG_02970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 340 aa AA seqDB search
MIIFRGKVKQKYALKYLQLLEQKGSLMYANRNAVATDLQRYIWCMDASSKRKNCTLSKTV
TMSWDDDDFDVPATKTAGVSWEDEDNDDPLLESWDIDEEEVARKKKEEEAKKKAEKEALK
QKQQEAKNKKLSQKSGERKLLDIDLIDEETRQELLRKAQVTSDLNNAADLFGGLGVANDD
DFDVNEHPRERAAKLAAAKQAAKPAAPRLTRDSPLEMHPLFQPTDKAEYEKLRKALATSL
QQLAEDSPLNYSSALGIDLIRDAAQPLSLENVRKVISTLNVIVKDKERAERQARLKKAGG
TATGGAGKKKAKPAVKTNVSDMYKKDAGDDFDDFDDDDFM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgattatattccgtggaaaagtgaagcaaaagtatgcactcaaataccttcaactcttg
gagcagaaagggtctctgatgtacgctaatcgtaacgctgttgcgaccgatttgcaacgg
tatatctggtgcatggatgcgagctccaaaagaaaaaattgcaccctgtcgaaaaccgta
accatgtcttgggacgatgatgactttgatgtgccagccaccaaaaccgctggtgtctca
tgggaagatgaagataacgacgatcctcttttagaatcttgggatatagacgaagaagaa
gttgcacgaaagaagaaggaagaagaagcgaagaagaaagctgaaaaggaggcattaaaa
cagaagcagcaagaagccaagaacaagaaattgtctcaaaagtctggcgagagaaaactt
ctcgacattgaccttattgatgaggaaactagacaagaattattgagaaaggcacaagtc
acctctgatttgaacaacgccgctgacctcttcgggggccttggagtggccaacgatgat
gacttcgatgtcaacgagcatccacgggagagagcggcaaagttggctgctgcgaaacaa
gcggctaagccagcagcacctagacttaccagagatagcccattagagatgcatcccttg
ttccaacctacagacaaggccgagtacgagaagcttagaaaggcacttgccacgtccctc
cagcagcttgcggaggactcgcctctcaattactcgtctgcattgggtatagatcttatc
agagatgctgcccagcctttatctcttgagaatgtcagaaaggtgatttcaactttgaac
gtcattgtcaaggataaggaaagagcagaaaggcaggcacggttgaagaaggccggtggt
acagccactggtggtgcaggaaagaagaaggccaaacctgctgtgaagacgaacgtcagc
gatatgtacaagaaagatgccggagacgactttgatgacttcgatgacgacgattttatg
tag

DBGET integrated database retrieval system