KEGG   Polymorphum gilvum: SL003B_3676Help
Entry
SL003B_3676       CDS       T01458                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_3676
   00030 Pentose phosphate pathway
    SL003B_3676
   00051 Fructose and mannose metabolism
    SL003B_3676
   00052 Galactose metabolism
    SL003B_3676
   00500 Starch and sucrose metabolism
    SL003B_3676
   00520 Amino sugar and nucleotide sugar metabolism
    SL003B_3676
  Nucleotide metabolism
   00230 Purine metabolism
    SL003B_3676
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SL003B_3676
Enzymes [BR:pgv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SL003B_3676
    5.4.2.8  phosphomannomutase
     SL003B_3676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3979875..3981374)
Genome map
AA seq 499 aa AA seqDB search
MFPKPESALKPNTYAFESRPMVKPTGFREYDARWLFEKEINLMGMQALGMGIGTLMHERG
IRPDIVVGHDFRSYSASIKMAVVNGLMAAGINVHDIGLALSPMAYFAQFALDVPAVAMIT
ASHNDNGWTGVKMGIDRPLTFGPDEMGRLKQIVLSAAFTTKSGGSYRFVDGFPDVYFRDL
TDRPKLARPIKIVAACGNGTAGAFAPRILEALGAEVIPLDTELDYTFPRYNPNPEDMKML
HALRDKVLETGAEVGLGFDGDGDRCGVVDNEGEEIFADKVGVMLARDISSLHPGSKFVVD
VKSTGLFNTDPVLQANGATTDYFKTGHSYIKRRVTELGAIVGFEKSGHYFFNAPIGRGYD
DGLVSAIAILDMLDRNPDKTMADLRRDLPKTWGSPTMSPHCDDEIKYDVVDRVVARFKAM
KDVGETIAGHSITDLITVNGVRVVTDDGTWGLVRASSNKPELVVVVESPASEERLHAMFK
AVDALLRENPEVGEYNQTL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaagcctgagtccgccctcaagcccaatacctatgccttcgaatcccggccc
atggtgaagccgaccggcttccgcgaatacgacgcgcgctggctgttcgagaaggaaatc
aacctgatgggcatgcaggcgctcggcatgggcatcggcaccttgatgcacgagcgcggc
atccgccccgacatcgtcgtcggtcacgatttccgcagctattcggcctcgatcaagatg
gccgtcgtcaacggtctgatggcggccggcatcaacgtccacgacatcggccttgccctg
tcgccgatggcctatttcgcccagttcgccctcgacgtgccggcggtggcgatgatcacg
gcctcgcacaacgacaacggctggaccggcgtcaagatgggcatcgaccggccgctgacc
ttcggtccggacgagatgggccgcctcaagcagatcgtgctgtccgccgccttcaccacg
aaatccggcggcagctatcgtttcgtcgacggcttcccggacgtctatttccgcgacctg
accgaccggccgaagctggcccggccgatcaagatcgtcgccgcctgtggcaacggcacc
gccggcgccttcgcgccgcgcattctcgaggcgctcggcgccgaggtgatccccctcgac
accgagcttgactacaccttcccgcgctacaacccgaacccggaggacatgaagatgctt
catgccctgcgcgacaaggtgctggagaccggcgccgaggtcggcctcggcttcgacggc
gacggcgaccgctgcggcgtggtcgacaacgagggcgaggagatctttgccgacaaggtc
ggcgtcatgctggcgcgcgacatctcgagcctgcatccgggctcgaagttcgtcgtcgac
gtcaagtcgaccggcctgttcaacaccgacccggtcctgcaggcgaacggcgctaccacc
gactacttcaagaccggccattcctacatcaagcgccgcgtcaccgagctcggcgccatc
gtcggcttcgagaagtccggccactacttcttcaacgcgccgatcggccgcggctacgac
gacggcctcgtctccgccatcgccatcctcgacatgctcgaccgcaacccggacaagacc
atggccgacctgcgtcgcgacctgcccaagacctggggctcgccgaccatgtcgccgcat
tgtgacgacgagatcaagtacgacgtcgtcgaccgcgtcgtcgcccgcttcaaggcgatg
aaggacgtcggcgagaccatcgccggccactcgatcaccgacctgatcaccgtcaacggc
gtgcgcgtcgtcaccgacgatggcacctggggcctggtgcgtgcctcttccaacaagccg
gaactggtcgtcgtggtcgagagcccggcgtccgaggaacgtctgcacgccatgttcaag
gccgtcgacgcgttgctgcgcgaaaacccggaagtcggcgaatacaaccagacgctctga

DBGET integrated database retrieval system