KEGG   Pseudoalteromonas haloplanktis: PSHAa1586Help
Entry
PSHAa1586         CDS       T00282                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain, Acetoacetyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSHAa1586 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSHAa1586 (atoB)
   00640 Propanoate metabolism
    PSHAa1586 (atoB)
   00650 Butanoate metabolism
    PSHAa1586 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAa1586 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PSHAa1586 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSHAa1586 (atoB)
   00310 Lysine degradation
    PSHAa1586 (atoB)
   00380 Tryptophan metabolism
    PSHAa1586 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSHAa1586 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa1586 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSHAa1586 (atoB)
Enzymes [BR:pha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSHAa1586 (atoB)
Exosome [BR:pha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSHAa1586 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1652439..1653632
Genome map
AA seq 397 aa AA seqDB search
MTKFNNNSVVILSAVRTAIGGFGGSLKNFTPAQLGTMCAKEALARANISPKQVGSCVVGK
VIHNGPKDAYLSRVIGLDAGLPISSHAVTLNRLCGSGLEAIIQAAQQIQLGDVNAALAGG
AESMSSSGYTLASNRWGQKMGDSTVVDELTTTLQDPWDNTPMGVTAESIAEKYSISRKQQ
DAYAAQSHHKAAKAITAGYFKQQIMPIEIKSRNGNQIFDTDEHVRADTTVEKLATLKPYF
KQNGTVTAATSSGINDGAAMLVLMSEQKANEQGLKPLGRLVGYARAGVEPSLMGTGPIPA
VQQVFDKTGLTIDDMDVIESNEAFAAQALCVGNELNFPEHRVNPNGGAIALGHPVGATGA
ILSTKCLYELKRINGKYGLVTMCIGGGQGIAAIFEAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttaataacaatagcgtagtaatattaagcgcagtacgcactgctatcggt
ggctttggtggcagccttaaaaacttcactcccgctcagttaggcactatgtgcgccaaa
gaagcattagccagagccaatatttcaccaaagcaagttggttcatgtgtggtaggtaaa
gtgatacataacggtcctaaagacgcgtatttgtcgcgagttattgggctagatgcaggg
ttaccaattagcagtcacgcggtaacactcaaccgcttgtgtggttcgggtttagaagcc
attatacaagcagcacaacaaattcaattaggtgatgtaaacgcagcattagcaggcgga
gcagaaagcatgagtagctcaggctatactctagcaagtaatcgttggggccaaaaaatg
ggtgatagtacagtagttgatgagctaactaccacattacaagacccatgggacaacaca
cctatgggcgttaccgctgaaagcattgcagaaaaatatagcattagccgcaagcaacaa
gacgcttacgcagcacaaagccatcataaagcggctaaagccattaccgcaggctatttt
aaacagcaaataatgcccatcgaaattaaatctcgtaacggtaatcaaatttttgatact
gacgagcatgttcgtgctgacacaacggtcgaaaaactcgccaccttaaaaccctacttt
aaacaaaatggtacagtcaccgcagccacctcatcaggtattaatgatggcgcagccatg
ttagtgcttatgtcggagcaaaaggccaatgaacaaggcttaaaaccactcggtcgccta
gtcggttatgccagagcaggtgttgagccttcattaatgggcacagggcctattcctgct
gtgcaacaggtgtttgacaaaactggattaactattgatgacatggacgtaatagaatca
aacgaagcctttgccgcacaggcattatgcgtaggcaatgagttaaactttcctgagcat
agagtaaaccccaatggcggagctatagcacttggccaccctgttggcgcaaccggtgct
attttatcgaccaaatgcctgtacgaactgaaacgcattaacggtaaatacggcttagtc
actatgtgtattggtggcggacaaggtatagctgctatttttgaagcgctttag

DBGET integrated database retrieval system