KEGG   Pedobacter heparinus: Phep_2319Help
Entry
Phep_2319         CDS       T00978                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
phe  Pedobacter heparinus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Phep_2319
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Phep_2319
Enzymes [BR:phe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Phep_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2700549..2701499)
Genome map
AA seq 316 aa AA seqDB search
MTKTLKIIEVKSEIGAGTRGASLGVDAIKIAALDFGSRFFKKHKSVEIPNENHLLLESTG
SPFAKRISGILTMVERVSDEVSATLNKDEFPIVLAGDHSTAAGTIAGIKAVHPKAKLGVV
WIDAHADLHSPYTTPSGNMHGMPLAMALDEDNLDAKVNKLDQETINYWYQLKNVGKIAPK
ISYRDLVLISAREMERPEEQLLKKNKVKIFTTAELRKRGVERTVIETLKYLDHCDLIYVS
FDVDSLDPTASRGTGTPVAQGLTEREAGNLMSRLITNQKVCCFEIVEVNPTLDRENQMAE
HAFEILIKATNAFRNE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgactaagactttaaaaattatagaagtaaaatctgagattggtgctggcactcgcggg
gccagtttaggagtggatgcaattaagattgcagcactcgattttggcagcagatttttt
aaaaaacataagtctgtagaaatccctaatgaaaaccatttattgctggaaagtacgggc
agcccatttgcaaaacggatttcgggtattttgacgatggtagagcgggtgagtgatgaa
gtaagtgctaccttaaataaagatgaatttccgattgttctggcaggcgaccacagcaca
gctgccggtactattgccggaattaaagcagtacatccgaaggcaaaattaggtgtggta
tggatagatgcgcatgcagatttacattctccttacactacaccttcaggaaatatgcat
ggaatgcctttggctatggcactcgatgaagataatttagatgccaaagtgaacaagctt
gaccaggaaaccatcaattactggtaccagcttaaaaatgtgggtaagatagcgcctaaa
atcagttaccgcgacctggtattgatctctgcaagagagatggagcgcccggaagaacaa
ttgcttaaaaagaacaaggtaaaaatatttactactgcagaactgcggaaaagaggagtg
gaacggacggtaatagaaacgcttaagtacctggaccattgcgacctgatctatgtttct
tttgatgtagattcacttgacccaacggcctcaagaggaaccggaacaccggttgcgcag
ggattaacggaaagggaagcgggtaatttaatgtctcgcctgattactaaccaaaaggtt
tgctgctttgaaattgtagaagtaaacccaacattagaccgggagaaccaaatggcagag
catgcctttgaaattttaattaaagctaccaatgctttcagaaacgaatag

DBGET integrated database retrieval system