KEGG   Pedobacter heparinus: Phep_2319Help
Entry
Phep_2319         CDS       T00978                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
phe  Pedobacter heparinus
Pathway
phe00220  Arginine biosynthesis
phe00330  Arginine and proline metabolism
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01130  Biosynthesis of antibiotics
phe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Phep_2319
   00330 Arginine and proline metabolism
    Phep_2319
Enzymes [BR:phe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Phep_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACU04523
UniProt: C6XYP1
Position
complement(2700549..2701499)
Genome map
AA seq 316 aa AA seqDB search
MTKTLKIIEVKSEIGAGTRGASLGVDAIKIAALDFGSRFFKKHKSVEIPNENHLLLESTG
SPFAKRISGILTMVERVSDEVSATLNKDEFPIVLAGDHSTAAGTIAGIKAVHPKAKLGVV
WIDAHADLHSPYTTPSGNMHGMPLAMALDEDNLDAKVNKLDQETINYWYQLKNVGKIAPK
ISYRDLVLISAREMERPEEQLLKKNKVKIFTTAELRKRGVERTVIETLKYLDHCDLIYVS
FDVDSLDPTASRGTGTPVAQGLTEREAGNLMSRLITNQKVCCFEIVEVNPTLDRENQMAE
HAFEILIKATNAFRNE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgactaagactttaaaaattatagaagtaaaatctgagattggtgctggcactcgcggg
gccagtttaggagtggatgcaattaagattgcagcactcgattttggcagcagatttttt
aaaaaacataagtctgtagaaatccctaatgaaaaccatttattgctggaaagtacgggc
agcccatttgcaaaacggatttcgggtattttgacgatggtagagcgggtgagtgatgaa
gtaagtgctaccttaaataaagatgaatttccgattgttctggcaggcgaccacagcaca
gctgccggtactattgccggaattaaagcagtacatccgaaggcaaaattaggtgtggta
tggatagatgcgcatgcagatttacattctccttacactacaccttcaggaaatatgcat
ggaatgcctttggctatggcactcgatgaagataatttagatgccaaagtgaacaagctt
gaccaggaaaccatcaattactggtaccagcttaaaaatgtgggtaagatagcgcctaaa
atcagttaccgcgacctggtattgatctctgcaagagagatggagcgcccggaagaacaa
ttgcttaaaaagaacaaggtaaaaatatttactactgcagaactgcggaaaagaggagtg
gaacggacggtaatagaaacgcttaagtacctggaccattgcgacctgatctatgtttct
tttgatgtagattcacttgacccaacggcctcaagaggaaccggaacaccggttgcgcag
ggattaacggaaagggaagcgggtaatttaatgtctcgcctgattactaaccaaaaggtt
tgctgctttgaaattgtagaagtaaacccaacattagaccgggagaaccaaatggcagag
catgcctttgaaattttaattaaagctaccaatgctttcagaaacgaatag

DBGET integrated database retrieval system