KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM019460Help
Entry
Phum_PHUM019460   CDS       T01223                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative (EC:3.1.4.11)
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:phu00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:phu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1274 aa AA seqDB search
MNLLKFKKNFCRRNLSTMAVIGMPNGLSFISEMEQTIIQLERGTLITRFFPRKKPERKML
MIRRETRQIIWCRSSSTKDFEGAVDMREIKEIRHGKNSKDFEKWPEESKKTDAGKCFVLY
YGQEFRLKSLSVAALSEKECELWLKGLRHLVPDTIKSPYPLLVERWLRKEFYTMESSRET
VSLKDIKAFLRRINYKISTCKLREAFQEVDTKKRNEIGFDDFTILHNKLIFDEVVRQHKF
LFTNNFDVYAAYSKNGKMVTLQEFQQFLAEVQKDPLGDNEQDVSQFMRDFLQDTVRNCQE
PFFTTMEFMDFLFSKHNDLWDEANDRIVQDMKRPLSHYWIASSHNTYLTGDQFSSESSIE
AYARALRMGCRCIELDCWDGPDGMPLIFHGHTLTTKIKFFDAIKTIKEHAFVTSEYPVIL
SIEDNCTLLQQRKMAQVMQEVFGEMLLSQPVEKNEKQLPSPWQLRRKIILKHKKLPDGVD
ENSVVIRNEDGAFIHILNGKLFYMCVTGREMDLRNTVKNGILYLEDPIDNEWNPHFFVLT
QNKLLYTDSFQGNNETDTEDDDEETGFQRHKEVNKFTFSISLSVPNDELHFSEMWFHGKL
GGKRAEAESLLKKYSHLGDGTFLVRESETFVGDYSLSFWRQGKVNHCRIRSKQDKGQTKY
YLIDTNSFDSLYSLITYYRSHPLRSQEFLIVLKEPVPQPNKHEGKEWYLPNVTRSQAEEM
LKRVPTDGAFLVRPSERGANSYAISFRAEKKIKHCRIKVDGRLYAIGSVYFESLVDLITY
YERHPLYKKIRLCHPVNEEIVQRIGQDVDDGTVYGTPGYMDPSSFTSKITVKAIYDYQAR
QEDELSFCKHAIITNVNKQDRGWWRGDYGGKKQHWFPCNYVEEIEPQENREDTVRENMSL
QKGSIDIVGAAIELVGGNRPGLEWILRIQNPNMLSPFEMAIPAREEALDWMAAIKETVKN
ASVRENQTKEKERAWRIAKEMSNLIVYCRSVAFNMERLKKNGFIFAEMSSFAENKAEKLI
CKEETRFFLKYHQHQFSRVYPKGQRIDSTNYNPVPMWNSGSQMVALNYQTPDKAMQINQS
KFSLNGGCGYILRPDFMFRDDFDMYDHHTLVGVDPMNISIRVIGARHLTRTGRGTTSPFV
EVEIIGADFDSGVKLTTKTISDNGFNPFWNEICDFDVYNPHFALLRFVVQDEDMFGDSNF
IGQCTYPVTAIRSGYRSVHLKNGFSEELELATLLIHITVRNPLESHHNGVGIRTSTLSTI
SRASTLVCGESSSN
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgaacttattaaaatttaaaaaaaatttttgtcgtagaaatttaagtacaatggctgtg
ataggtatgcctaatggtctgagttttatctcagaaatggaacaaactattattcaattg
gagagggggacacttattactaggttttttccgcgaaaaaaacctgaaagaaaaatgttg
atgataagaagagaaacaaggcagataatttggtgcagatcatcatcaactaaagatttt
gaaggagcagtggatatgagagaaattaaggaaataagacatggaaaaaattctaaagat
tttgaaaagtggcctgaggaaagtaaaaaaacagatgcaggaaaatgttttgttttatat
tatggtcaggaatttcgattaaagtcactttcagtcgcagctttatcagaaaaagaatgc
gaactgtggttaaaaggattaagacacttagtgccagatacgattaaatctccttaccca
ttgttagtagaaagatggttaagaaaagaattttacacgatggaaagcagcagagaaaca
gtaagtttaaaagatataaaagcatttttgagaagaatcaattataaaatatcaacttgc
aaattaagagaggcatttcaagaagttgacacgaaaaaacgaaatgaaatcggttttgac
gattttactatcctccataataaacttattttcgatgaagtggtaagacagcataagttt
ttattcactaataactttgatgtgtatgctgcttactcaaaaaatggtaaaatggtaaca
ttgcaagagtttcaacagtttttagcagaggttcaaaaagatccattaggtgataatgaa
caggatgtttctcaatttatgagagattttctacaggacactgtaagaaattgtcaggaa
ccattttttacaacaatggaatttatggattttttattttcaaaacataatgatttatgg
gacgaagctaacgatagaattgtacaagacatgaaaagacctttgtcccattattggatt
gcttcttcgcacaatacatatttaaccggagatcaattttcgagtgagtcttccattgag
gcttatgccagagcattgcgtatgggttgcagatgtatcgaacttgattgttgggatgga
ccagacggaatgcctctcatatttcacggtcacactttaacaactaaaattaaatttttc
gatgctataaaaaccataaaagaacacgcatttgtgacttcagaataccctgtgatatta
tctatagaagacaattgcactctactccagcaacgtaaaatggctcaagttatgcaagag
gttttcggtgaaatgttgttatcacaacccgttgaaaaaaatgaaaaacaacttccttct
ccttggcaacttcgccggaaaattattttaaaacataaaaaacttcccgatggcgttgat
gaaaattctgtcgttatcagaaatgaggatggtgcgtttatccatattttaaatggtaaa
cttttttatatgtgtgtcacaggtagagaaatggatttgaggaacacggtaaaaaatggc
attttgtatctggaagatcccatagataatgaatggaatcctcattttttcgtattgact
caaaacaaattactttacacggatagttttcaagggaataatgaaaccgatacggaagac
gatgatgaagaaaccggatttcaaaggcacaaagaggttaataaatttacattttctatt
tctttgtccgtgccaaatgacgaattgcactttagtgaaatgtggtttcacggcaaactg
ggagggaaaagagcggaagccgaaagtttattaaaaaaatattcacatttaggcgatgga
acttttttagtcagagaaagcgagacttttgtaggagattattctttgtcattttggaga
caagggaaagttaatcattgcagaatcagatcgaagcaggataaaggacaaaccaaatat
tatttgattgacacgaatagttttgatagtttatatagtttaataacgtattatagaagt
catcctctcagaagtcaggaatttttaattgttttgaaagagccggttccgcagccgaac
aagcacgagggaaaagaatggtatttacccaacgtgacgaggagtcaagccgaagaaatg
cttaaacgggtgccaaccgatggcgcgtttctagtcaggccaagcgaaagaggtgccaac
tcatatgccatttcatttagagcggagaaaaaaattaaacactgccgaattaaagtcgac
ggaagactgtatgccataggatcggtttattttgaaagcttggtcgatttaataacttat
tacgaacgtcatccgctgtataaaaaaataagactttgtcatccggtgaatgaagaaatc
gtgcaaaggataggccaggacgtcgacgatgggaccgtttacggaactcccggttatatg
gatccgagtagtttcacatcgaaaatcacagtcaaagccatttacgattatcaggctcga
caagaggacgaattgtcgttttgcaagcatgccatcataacgaacgttaataaacaggat
aggggttggtggagaggggattacggtggtaaaaaacaacattggtttccgtgtaattac
gtggaagaaatcgaaccgcaagaaaatcgagaagacacggtacgtgaaaacatgtctctt
caaaagggaagcattgacatcgtgggtgcggcaatcgaattggtcggtggaaatcgtccg
ggtttggaatggattttacgaattcaaaatcccaacatgttgtcacccttcgaaatggcg
atacccgcgagagaagaagcgttggattggatggccgccattaaagaaactgttaaaaat
gcaagcgtgagggaaaatcaaacgaaagaaaaagaaagagcctggagaatagctaaggaa
atgtctaatttgatagtttactgcaggtcggtggcattcaacatggaaaggttaaaaaaa
aacggttttatttttgcggaaatgtcatcgtttgcggaaaacaaagcggaaaaattaata
tgcaaagaagagacgagattttttttgaaatatcatcagcatcagttcagtagagtttat
ccaaaaggtcaacgaatagattcgacaaattacaatcccgttcccatgtggaattcaggt
tcgcaaatggtcgctctcaattatcagacaccagataaagcaatgcaaataaatcaaagc
aaatttagtttgaacggtggttgcggttacattctaagaccggatttcatgtttcgagat
gatttcgacatgtacgaccatcacactctcgtcggtgtcgatcccatgaacatatcgatc
agagtgatcggagcgaggcatttgacaaggacgggaagaggaacgacgagtccttttgtc
gaagtcgaaataatcggagcggattttgattccggtgtaaaactcacgacgaaaacgatt
tccgacaacggttttaatcccttctggaacgaaatatgcgatttcgacgtttacaatcct
catttcgctcttttacgattcgtcgtacaagatgaagacatgtttggcgatagtaatttt
attggacaatgcacgtacccggtgacagccataagatcaggttatcgtagcgttcattta
aaaaatggattcagcgaagaattggaattggcgactctactcattcacataaccgtacga
aatcctcttgagagtcatcacaacggagtaggaataagaacgagtaccctgtcgacgata
tcgagagcttcgactttggtgtgcggtgaaagttcctccaattga

DBGET integrated database retrieval system