KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM285470Help
Entry
Phum_PHUM285470   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:phu01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:phu00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:phu00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:phu00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 401 aa AA seqDB search
MIIQKLAASQCGFRALMSLQLKKQIMNFTSSAVRYSEQHDDKEVIIESLSGGKGSFTLNR
PKQLNTLNLCMVCQIRPTLISWSQDKYLILMKGAGEKAFCAGGDVVSVVKDKTGETGKKF
FREEYKMDALISCLKIPYVAIINGITMGGGVGISIFGKYRIATETSLFAMPETQIGFFPD
VGVSYVLARMPNQLGPFLGLTGYRLKGYDLIHAGVATHFCSTKNLCELEKALLCDFSRDC
CSCPEEIIKEFQEKSLKDIGQSPPKFSLEPHLKTIETWFCDDTFESVYSKISKDSSKFGT
DTKELLSSMSPLSLKVTYKQIKDAANLDKFDCFNVDYRIACRMLECGDFAEGVRALLIDK
DKKPKWKHSDVSKVTDEEVSNFFNPLPEEEELRLPDTIYDP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaaaaattagcggcgtcacagtgcggattccgtgctttgatgtctttacaa
ttaaaaaaacaaataatgaattttacaagttctgccgttagatattcagaacaacacgac
gataaagaagttattattgaaagtttatcaggtggaaagggttcatttacattaaacagg
ccaaaacaattaaatacattaaatttatgtatggtatgtcaaataagacccactcttatt
agttggagccaagacaaatatttaattttaatgaaaggagccggtgaaaaagcattttgt
gccggtggtgatgttgtttccgtcgtcaaagataaaactggagaaactgggaaaaaattt
ttcagagaagaatacaaaatggatgctttgatctcctgtctaaagattccttatgttgct
ataataaatggaataacaatgggagggggagtaggtatttcaatttttggtaaatatcga
atcgctacagaaacatcactttttgctatgcctgaaactcaaataggatttttccctgat
gttggagtgtcctacgtattagcccgtatgcctaatcaattgggtccttttctgggactc
acgggttacaggctgaagggctacgatttgattcacgccggagttgcaacgcatttttgt
tcgacgaaaaatctttgcgagcttgaaaaagctctcctttgtgacttttccagagattgt
tgcagttgcccagaagagatcatcaaagaatttcaggaaaaatcactcaaagatatcggc
caaagcccgccaaaattttcattggaaccacatttaaaaacaatcgaaacgtggttttgc
gatgatactttcgaaagtgtttacagcaaaatatccaaggattcttctaaatttggaacg
gacaccaaagaattattatcatcaatgtctcccctatcattaaaagtaacatataaacaa
ataaaagatgctgcaaatttagataagtttgattgtttcaatgtcgattatagaatagct
tgcagaatgttggaatgtggagattttgcagaaggtgtgagagctttgcttatcgacaaa
gataaaaaaccaaaatggaagcattctgacgtatcgaaagtaaccgatgaagaagtttca
aacttttttaatcccttgcctgaagaagaagaacttcgtctccccgatacaatttatgat
ccctaa

DBGET integrated database retrieval system