KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM285470Help
Entry
Phum_PHUM285470   CDS       T01223                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Phum_PHUM285470
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Phum_PHUM285470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Phum_PHUM285470
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phum_PHUM285470
Enzymes [BR:phu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Phum_PHUM285470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 401 aa AA seqDB search
MIIQKLAASQCGFRALMSLQLKKQIMNFTSSAVRYSEQHDDKEVIIESLSGGKGSFTLNR
PKQLNTLNLCMVCQIRPTLISWSQDKYLILMKGAGEKAFCAGGDVVSVVKDKTGETGKKF
FREEYKMDALISCLKIPYVAIINGITMGGGVGISIFGKYRIATETSLFAMPETQIGFFPD
VGVSYVLARMPNQLGPFLGLTGYRLKGYDLIHAGVATHFCSTKNLCELEKALLCDFSRDC
CSCPEEIIKEFQEKSLKDIGQSPPKFSLEPHLKTIETWFCDDTFESVYSKISKDSSKFGT
DTKELLSSMSPLSLKVTYKQIKDAANLDKFDCFNVDYRIACRMLECGDFAEGVRALLIDK
DKKPKWKHSDVSKVTDEEVSNFFNPLPEEEELRLPDTIYDP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaaaaattagcggcgtcacagtgcggattccgtgctttgatgtctttacaa
ttaaaaaaacaaataatgaattttacaagttctgccgttagatattcagaacaacacgac
gataaagaagttattattgaaagtttatcaggtggaaagggttcatttacattaaacagg
ccaaaacaattaaatacattaaatttatgtatggtatgtcaaataagacccactcttatt
agttggagccaagacaaatatttaattttaatgaaaggagccggtgaaaaagcattttgt
gccggtggtgatgttgtttccgtcgtcaaagataaaactggagaaactgggaaaaaattt
ttcagagaagaatacaaaatggatgctttgatctcctgtctaaagattccttatgttgct
ataataaatggaataacaatgggagggggagtaggtatttcaatttttggtaaatatcga
atcgctacagaaacatcactttttgctatgcctgaaactcaaataggatttttccctgat
gttggagtgtcctacgtattagcccgtatgcctaatcaattgggtccttttctgggactc
acgggttacaggctgaagggctacgatttgattcacgccggagttgcaacgcatttttgt
tcgacgaaaaatctttgcgagcttgaaaaagctctcctttgtgacttttccagagattgt
tgcagttgcccagaagagatcatcaaagaatttcaggaaaaatcactcaaagatatcggc
caaagcccgccaaaattttcattggaaccacatttaaaaacaatcgaaacgtggttttgc
gatgatactttcgaaagtgtttacagcaaaatatccaaggattcttctaaatttggaacg
gacaccaaagaattattatcatcaatgtctcccctatcattaaaagtaacatataaacaa
ataaaagatgctgcaaatttagataagtttgattgtttcaatgtcgattatagaatagct
tgcagaatgttggaatgtggagattttgcagaaggtgtgagagctttgcttatcgacaaa
gataaaaaaccaaaatggaagcattctgacgtatcgaaagtaaccgatgaagaagtttca
aacttttttaatcccttgcctgaagaagaagaacttcgtctccccgatacaatttatgat
ccctaa

DBGET integrated database retrieval system