KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM444970Help
Entry
Phum_PHUM444970   CDS       T01223                                 

Definition
Regulatory-associated protein of mTOR, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:phu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Phum_PHUM444970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1284 aa AA seqDB search
MSMTTAIQHSYNEEDVSECVDWQLPLSFVKKRHTENIEGESATTQTWRMKERMKTVSVAL
VLCLNVGVDPPDIVKTQPCARLECWIDPLSMSSQKALETIGGNLQKQYEKWQPRARYKQS
LDPTVDEVKRLCTSLRRNAKDERVLFHYNGHGVPKPTTNGEIWVFNRTYTQYIPLSIFDL
QTWMGTPSIYVYDCSNAGTIVSSFKQFADQHEKEYEVAANQNRGTSGSIPSFKNCIQLAS
CAANQVLPMNPDLPADIFTSCLTTPIKIALRWFVMQTTSKLVPKITLDLIDRIPGQLNDR
RTMLGELNWIFTAITDTIAWNTLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYDCTPV
SSPKLPSTYQHPMWQAWDLALDLCLAQLPGILENDEPFVHSPFFEEQLTAFQVWLDLGGE
HRNPPEQLPIVLQVLLSQVHRLRALELLGRFLDLGPWAVNLALSVGIFPYVLKLLQSSAR
ELRPLLVFIWAKILAVDSTCQSDLVRDNGHKYFLSVLQDTSVPSEHRTLSAFVLASIVNN
YQAGQEAGLQGSLVSICLEQLNDPNPLLRQWVSVCLARLWTNYDRARWCGVRDIAHEKLY
ALLQDSEPEVRAAAVYALGTFISSVLDRTEHANSIDHSVATMLLNVVSLDMSPLVRQELI
VALQWMILLFENSFISVALAEECKNKESPLSPNIVVVNDLLLSPQSGLKRIASRDRLGKI
LPSNSNYDGTAVAVDLLPSSSIDRIKRVSSSSSISSLGYNPNTSLHQMPFGSIYTKLWYG
LTSLENDPYPAVRKMARTVVDKIREQIQVLGREPHASNKDVHDTKTSSVSLPPSPSNRTS
YLTEDSPPSLITGSASDLNKLAIRSATHISLKIRKNMPNTINEESDESSNTKKPLVSTQF
VEWSSKYFAQPIMGIHDENDLESKSYYEKEWRYLRNASLRNDCKEEQKKILNGRLEHQIF
NSRSPDSPNVIMFHPYETHLAVAAKDYYGIWDWNSGSKLCYCSNKAAKGSRITAMQFVNV
HDVTLLLNGSDDGTVRLWSNYLPRENREPELVTAWQALPDVTPSNRSVNGGAGIVMVWQQ
ESQQLVVAGDTSKIRFWDAEKELKIVDLHTGTESCVTSISSDPSCSNLVVVGCGDGSVRL
FDRRLSPQDARVMTWREHSAWVVGVHLKAKSPEEGRLISGCVAGDVRFFDIRKNTSVCTC
QTSHGMTTMAVHNMTEIFCCGSVSQFISVYKTTGTELNVIKYHEGFMGSRIGTVSCLSLH
PYRVALAAGSVDCTLSVFSGDPKR
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgacgactgccatacaacacagttataatgaagaagatgtttcagaatgtgta
gattggcaactaccactctcgttcgtaaaaaaacgtcatactgaaaatattgaaggagaa
agcgcaaccactcaaacatggagaatgaaagaaagaatgaaaacagtcagtgtggctttg
gtattgtgtttgaatgttggagtggacccaccagatattgtaaaaactcagccttgtgca
agactggaatgttggatagatccattatctatgagttcacagaaagctttagaaactatc
ggtggaaatcttcaaaaacaatatgaaaaatggcaaccaagagccaggtataagcaaagt
cttgatcctactgttgatgaagttaaaagattatgtacttctttaagaagaaatgcaaaa
gatgaaagagttttgtttcactataatggccatggagttccaaaacctacaacaaatggt
gaaatatgggtttttaacagaacttacacccaatatattcctctcagcatttttgattta
caaacatggatgggaactccttcaatttatgtttatgattgttcaaatgctggtacaata
gtttcttcatttaaacaatttgcagatcaacatgaaaaagaatatgaggttgctgcaaat
caaaacagaggaacttctggatctattccaagttttaaaaactgtattcagctggcatca
tgtgcagctaatcaagtactgccgatgaacccagatcttccagctgatatttttacttct
tgcttgacaactcctattaaaatagctcttagatggtttgttatgcaaacaacttcaaaa
ttagttccaaaaattacgttggatttaattgatagaattcctggtcaattaaatgatcga
cgaactatgttgggagaattaaactggatttttactgcaataacagacacaatagcctgg
aacacattacccagagatttatttcaaaaattatttagacaggatttacttgttgctagt
ctttttaggaattttttgctagctgaaagaataatgagatcatacgattgtacaccagta
tcttctccaaaattaccttcaacctatcagcatccaatgtggcaagcatgggatttagca
ttagatttgtgtttggctcaattaccggggattttagaaaacgatgaaccatttgtgcat
tcaccatttttcgaagagcaattgacagcttttcaagtgtggttggatcttggaggagaa
catagaaaccctcctgaacaacttcctatagttttgcaggttcttttaagtcaagttcac
agattaagagctctggagcttttgggacgttttttggatttaggaccttgggctgtaaat
ttagctttatccgtgggtatatttccatatgtactaaaattgcttcagagttcagcaaga
gaattgagacccctgttggtattcatctgggcaaaaattttagctgttgatagtacgtgt
cagtcagatcttgttagagataacggacataaatactttttatcagtcttacaagatacc
agtgtacctagtgaacatagaactctctctgcttttgtacttgcgtctattgtaaacaat
tatcaagcgggccaagaagctggtctgcaaggttctttagtatcaatatgtcttgagcaa
ttgaatgatccaaatccgttgttacgtcaatgggtatcagtttgtttggctagattgtgg
actaattacgatcgagctaggtggtgtggagttagagacattgctcacgaaaaactttat
gctttattacaagacagtgaacccgaagtccgcgctgcggctgtatacgcacttggaacc
tttataagctcagttttggatagaacggaacatgctaattcaattgatcacagtgtggcc
accatgcttcttaatgttgtatctttagatatgtctccgttagtgcgacaagaacttata
gtagcattacaatggatgatactactatttgaaaattcttttatttccgtggcattggct
gaagaatgtaaaaataaagaaagtcctctcagtccaaatatcgtagttgttaatgattta
ttgctctcaccgcagtccggtttaaaaagaatagcttctagagatagattgggtaaaatt
ttgccatcaaatagtaattacgatggaacagccgtagctgtagatttgttaccctcttcc
tccatcgacagaataaaaagagtgtcttctagttcatcgataagtagtttaggttacaat
cctaatacttccttacatcaaatgccgttcggaagcatttatacaaaattatggtacggt
ttaaccagtttagaaaatgatccatatcctgccgttaggaaaatggcacggacggttgta
gacaaaataagagagcaaattcaagttttaggccgggaacctcatgcaagtaacaaagac
gttcacgacacaaaaacgtcgtctgttagtttgcctccgtctccttccaacagaacatct
tatctcacagaagactccccgccatctttaattaccggttcagcgtcagatttaaataaa
ttagcaatcaggtctgcgacgcatataagtttaaaaataagaaaaaatatgcccaacaca
attaatgaagaatccgatgaatcttctaatacgaaaaaaccgttggtgagcacacaattc
gtagaatggagttctaaatattttgctcaacctataatgggaatacacgatgaaaatgat
ttagaatctaagtcttattacgaaaaagaatggaggtacttaagaaacgcttctctgaga
aatgactgcaaagaagagcaaaaaaaaattttgaacggtagattagagcatcagattttc
aacagcagaagtcctgattctcctaacgttattatgtttcatccctacgaaacccatttg
gcagtggcagcaaaggattattacgggatttgggattggaactctggctcaaaattatgt
tattgctcaaacaaagccgcgaaaggatccagaataaccgcaatgcaattcgtcaacgtt
cacgatgtcacgcttttattgaacggatccgacgacggtactgttcgcctttggtcaaat
tatttgccgcgagaaaacagagaaccggagttggtgaccgcgtggcaagccctgcccgat
gtgacgccatcaaacagatccgttaacggcggagcgggtatcgtaatggtatggcaacag
gaatcgcagcaattggtcgttgcgggcgacacttcgaaaatcaggttttgggatgcagaa
aaagaattgaaaatagtcgatttgcacacgggaaccgaatcttgcgtcacgagcatttct
tcggatccatcttgttctaacttggttgtcgtcggatgcggagacggatccgtacgattg
ttcgatcgaagattatctcctcaagatgcgagagttatgacgtggagagaacattctgcg
tgggttgtcggcgttcatttgaaagccaaatccccggaggaagggcggcttatcagtgga
tgcgttgccggagacgtgagatttttcgacataaggaaaaacacgtcggtgtgcacgtgt
caaacgtcacacggtatgacgaccatggctgttcataacatgactgaaatattttgttgc
ggttcagtgagtcaattcatatcagtgtacaaaacgacgggaacggaattgaacgtgatt
aaatatcacgagggttttatgggttccagaatcggaaccgtgagctgtttatcacttcac
ccgtacagagttgctttggctgcaggctctgtcgactgcacattgagtgtcttttccggt
gatccgaaaagatga

DBGET integrated database retrieval system