KEGG   Scheffersomyces stipitis: PICST_54024Help
Entry
PICST_54024       CDS       T01023                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pic  Scheffersomyces stipitis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PICST_54024
Enzymes [BR:pic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PICST_54024
Exosome [BR:pic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PICST_54024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 340 aa AA seqDB search
MVHTAEYLPETGTKIGSVLQGGYNHPLAREWQSEKQLTKNMFIFPLFVSDEPDEETEIPA
LPNIKRYGLNKLIPYVKTLVDKGLRAVILFGVPLKEGVKDEVGTAADDPEGPVILSIKAL
KKNFPDLYVMCDVCLCEYTSHGHCGVLYEDGSLNRETSALRIGAVAVNYAKAGANCVAPS
DMVDGRIKDIKVGLIDAGLAHKCLVMSYAAKFSGNLYGPFRDAAGSAPSHGDRKAYQLPP
GGAGLARRALLRDMEEGADAVIVKPSTFYLDIISDASRLCHDYPICAYHVSGEYAMLHAA
AEKGIVDLKGIAFESHQGFLRAGARLIISYFTPEFLEWLD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtccacacagcagagtatcttcccgaaaccggtaccaaaatcggctcggttctccaa
ggtggctacaaccatccgcttgccagagagtggcagctggaaaaacagttaaccaagaac
atgttcattttcccgttattcgtatccgatgagccagatgaagagactgaaattcctgct
ttgccaaacatcaagagatatgggctcaacaagttgattccgtatgtcaagactttggtc
gacaaaggacttcgtgctgtgatcttgtttggtgtacctttgaaagaaggtgtcaaggac
gaagtaggaacggcagctgatgatccagagggcccagtgatcttgagcatcaaagcattg
aagaaaaacttcccagacttgtatgtcatgtgtgacgtctgcttgtgcgaatatacgagc
catggacattgcggtgtattgtacgaagacggttccttaaacagagagacttcggcattg
agaatcggtgccgttgccgttaactacgctaaggcgggtgctaactgtgtagctccatct
gatatggttgacggtagaatcaaagatatcaaagtaggtctcatcgacgcaggtttggct
cataagtgtcttgtaatgtcttacgccgccaagttctctggtaacttgtatggacccttc
agagatgctgccggctcagctcctagccacggtgacagaaaggcttaccagttaccacca
ggtggtgctggcttggctcgtagagctcttttgagagatatggaagaaggtgccgacgct
gtcattgtcaaaccttcaactttctatcttgacatcatcagcgacgcttccagattatgt
cacgactatccaatctgtgcctaccatgtcagtggagagtatgccatgttgcatgctgct
gccgaaaagggcatagttgatttgaagggcatagcttttgagtctcaccagggtttcttg
agagcaggcgccagattgatcatcagttactttactccagagttcttagaatggcttgat
tag

DBGET integrated database retrieval system