KEGG   Phytophthora infestans: PITG_03176Help
Entry
PITG_03176        CDS       T01333                                 

Definition
hypothetical protein
Organism
pif  Phytophthora infestans
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 851 aa AA seqDB search
MTTDPVALLPTDVESRERIPGSPLVPGGVSWSEDGRLAVVSDSSVLVATFRSRELEMFQP
GGPAVSKDFVFLPEHPVNEHVPVAIPPVIESLDSGLPRASTTYFLLNEGDRHQHNPKELS
LSKNTGAAFIAAVWGPRGSGPSSSCALLAITASSRLSLHFPPSFHMNWNEVAVFSEDLFK
FFESKSFRLGPSHDERLNTPPPSTAMAAPRGDKSGKKNKKRKMDPADGYLAMNSVAEYTH
RCAMMSTLTVAWSPFMVTADKQSTTSLIAFSGRKVSTIWAYAYPSFVAGQHVEPFLSSAP
AAWIDTEKYGWVSTSTWQQMHRHGTAYATRGDLGLALGTSEGNVLIATVPVRVSATDDSP
QELAVDRVIVSPHSQPVFGLCMGSRWTFSNSPTNGLIVASGSTISVWNLKKKKQAQPNAK
WKAHDGNVTGLDTNYFGDTIISAAVDGTIKVWEKTTGNKYPVFGLAMSPSSAQLACVFII
PPASRPNRKSQADVSYSRVSSSLEYIPSPWVKTPDQLVDVVCRILDESQSVSSFMDVVWF
CYNDNAAVMSLNGSTDLAIPALLNKINGEPSDSEVLARQPIYLHLCEELEKRYYESTQAS
SSTANGGRPPIPLYLQASLLLRSAITPAEHQIAAQNAALAKIRRTLSVYWAERCLTALVA
ASKKAEKSLRDYLESSTSEKTSALVMADFLSVQDPLAQRSEALVTHIYDQLDSPVHVATW
IAHVKTKANASTEDQPAEEPAVAGAVYTPPSRETCFICEKSVPFGELEIVCGSGHTLERC
FLSFCCISAMDVWKCMGCGVSASEIDLSSGTSPFYLLDLEERDDKEIATPAASRMKIICR
LCGSYCSFSKY
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgatccagtagcgctgctgccgacggatgtcgagtcccgcgagcgaatcccc
ggcagtccattagtccctggcggtgtatcgtggtccgaagatggacgtctcgctgtcgtg
tccgactcaagcgttcttgtcgccacgttccgcagtcgtgaactcgagatgttccagcct
gggggcccggctgtatccaaagactttgtgttcctaccagaacacccagttaacgagcac
gttccagttgcaatcccgccagtcatcgagtctcttgactctggacttccgcgagccagc
accacgtactttttactcaacgagggcgatcgtcaccagcacaaccccaaggagctgtca
ctgtccaagaacacgggcgcagcgttcatcgctgctgtgtggggaccgcggggctccggt
ccaagtagttcttgcgccttattagcgatcacagcgtcctccagactgagtctacacttc
ccaccgagtttccacatgaactggaatgaggtcgctgtgttttccgaggatctcttcaag
ttcttcgagagcaagagcttccggttgggaccctcacatgatgaacgacttaatacaccg
cctccaagtacagcaatggctgcaccgcgcggagataaatccggcaagaagaacaagaag
aggaagatggacccagcagacggatatctcgcgatgaactcagtggcagaatacacgcac
cgatgcgccatgatgtcgaccttaacggtggcttggtcgccattcatggtgacggcggat
aaacagagtacgacgtcgcttattgcgttctctggacgcaaagttagcaccatttgggcg
tacgcgtacccttcctttgtagcaggacagcacgtcgagccttttctttcgtctgcaccc
gctgcgtggattgatacggagaagtatgggtgggtgtccacgagcacgtggcagcagatg
catcgacatgggacggcgtacgcaacacggggagaccttggcttggcgctaggtacgtcg
gagggcaatgtactgattgcgacggtccctgtgagagtaagtgcaactgatgattcgcct
caagagttagctgtggatcgcgttattgtgtcgccacattctcaaccagttttcggactg
tgtatgggaagtcggtggacgttttccaacagcccaacaaatggtctgatcgttgcgtct
ggctcgacgatctcagtgtggaacctcaagaagaagaaacaagcgcagcccaatgccaag
tggaaggcacacgatggtaacgtgactggactggacacgaactacttcggagacacgatc
atctcagctgctgtggatggaacgatcaaagtctgggagaagacaacgggtaataaatac
cctgtgtttgggctggcgatgtcgcccagctctgcccagttggcgtgcgtgttcattatc
cctcctgcgtcccgacccaatcgaaagtcacaggccgacgtctcttacagtcgagtatca
agctctcttgagtacattccgtcgccgtgggtgaaaaccccagaccagcttgtggacgtc
gtgtgcaggattctagacgagagtcagtcggtgagtagcttcatggatgtggtgtggttc
tgctataacgacaatgcagcggtcatgtcactcaacggatccacagacttggcaattcct
gccttgttgaacaagataaacggcgagccaagcgacagtgaagtactcgcacgtcagccg
atatatctacatctctgtgaagagctggagaagcgctactacgagtccacacaggcttcg
agctccacagcaaacggcggcaggcctcccattccactgtatctacaggcgtcgctgttg
ctgcgcagtgcaataacaccggcagagcaccaaatagccgctcaaaatgcagcgctggca
aagattcgacgcaccttgagtgtatactgggcggagcgctgcttaacggcgcttgtggcg
gcatctaagaaggcagaaaagtcacttcgagactatcttgaaagctccacgtctgagaag
accagcgcactggtgatggccgatttcctcagtgttcaagaccccttagcccaacgtagt
gaagcacttgttacgcacatctacgaccaactagattcgccggttcacgttgccacatgg
atcgcacacgtgaagacaaaggcgaacgcaagtactgaggaccagccagctgaagagcct
gctgtggccggtgcagtgtatacgccgccatcacgagaaacgtgcttcatttgcgagaag
agtgttccattcggagaacttgagattgtctgcgggtctggccatactctggagagatgc
ttcctctcattctgctgcatttcggccatggacgtgtggaagtgtatgggctgtggggtg
tcagcgtctgaaatcgacttgtccagtggcacatccccattttatttattggacttggag
gaacgtgacgacaaggaaatcgctactcccgctgcttcgaggatgaagatcatttgtcgt
ctgtgtggcagctactgtagcttctcgaaatattga

DBGET integrated database retrieval system