KEGG   Phytophthora infestans: PITG_03176Help
Entry
PITG_03176        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
pif  Phytophthora infestans
Brite
Enzymes [BR:pif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PITG_03176
Transcription machinery [BR:pif03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     PITG_03176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 851 aa AA seqDB search
MTTDPVALLPTDVESRERIPGSPLVPGGVSWSEDGRLAVVSDSSVLVATFRSRELEMFQP
GGPAVSKDFVFLPEHPVNEHVPVAIPPVIESLDSGLPRASTTYFLLNEGDRHQHNPKELS
LSKNTGAAFIAAVWGPRGSGPSSSCALLAITASSRLSLHFPPSFHMNWNEVAVFSEDLFK
FFESKSFRLGPSHDERLNTPPPSTAMAAPRGDKSGKKNKKRKMDPADGYLAMNSVAEYTH
RCAMMSTLTVAWSPFMVTADKQSTTSLIAFSGRKVSTIWAYAYPSFVAGQHVEPFLSSAP
AAWIDTEKYGWVSTSTWQQMHRHGTAYATRGDLGLALGTSEGNVLIATVPVRVSATDDSP
QELAVDRVIVSPHSQPVFGLCMGSRWTFSNSPTNGLIVASGSTISVWNLKKKKQAQPNAK
WKAHDGNVTGLDTNYFGDTIISAAVDGTIKVWEKTTGNKYPVFGLAMSPSSAQLACVFII
PPASRPNRKSQADVSYSRVSSSLEYIPSPWVKTPDQLVDVVCRILDESQSVSSFMDVVWF
CYNDNAAVMSLNGSTDLAIPALLNKINGEPSDSEVLARQPIYLHLCEELEKRYYESTQAS
SSTANGGRPPIPLYLQASLLLRSAITPAEHQIAAQNAALAKIRRTLSVYWAERCLTALVA
ASKKAEKSLRDYLESSTSEKTSALVMADFLSVQDPLAQRSEALVTHIYDQLDSPVHVATW
IAHVKTKANASTEDQPAEEPAVAGAVYTPPSRETCFICEKSVPFGELEIVCGSGHTLERC
FLSFCCISAMDVWKCMGCGVSASEIDLSSGTSPFYLLDLEERDDKEIATPAASRMKIICR
LCGSYCSFSKY
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgatccagtagcgctgctgccgacggatgtcgagtcccgcgagcgaatcccc
ggcagtccattagtccctggcggtgtatcgtggtccgaagatggacgtctcgctgtcgtg
tccgactcaagcgttcttgtcgccacgttccgcagtcgtgaactcgagatgttccagcct
gggggcccggctgtatccaaagactttgtgttcctaccagaacacccagttaacgagcac
gttccagttgcaatcccgccagtcatcgagtctcttgactctggacttccgcgagccagc
accacgtactttttactcaacgagggcgatcgtcaccagcacaaccccaaggagctgtca
ctgtccaagaacacgggcgcagcgttcatcgctgctgtgtggggaccgcggggctccggt
ccaagtagttcttgcgccttattagcgatcacagcgtcctccagactgagtctacacttc
ccaccgagtttccacatgaactggaatgaggtcgctgtgttttccgaggatctcttcaag
ttcttcgagagcaagagcttccggttgggaccctcacatgatgaacgacttaatacaccg
cctccaagtacagcaatggctgcaccgcgcggagataaatccggcaagaagaacaagaag
aggaagatggacccagcagacggatatctcgcgatgaactcagtggcagaatacacgcac
cgatgcgccatgatgtcgaccttaacggtggcttggtcgccattcatggtgacggcggat
aaacagagtacgacgtcgcttattgcgttctctggacgcaaagttagcaccatttgggcg
tacgcgtacccttcctttgtagcaggacagcacgtcgagccttttctttcgtctgcaccc
gctgcgtggattgatacggagaagtatgggtgggtgtccacgagcacgtggcagcagatg
catcgacatgggacggcgtacgcaacacggggagaccttggcttggcgctaggtacgtcg
gagggcaatgtactgattgcgacggtccctgtgagagtaagtgcaactgatgattcgcct
caagagttagctgtggatcgcgttattgtgtcgccacattctcaaccagttttcggactg
tgtatgggaagtcggtggacgttttccaacagcccaacaaatggtctgatcgttgcgtct
ggctcgacgatctcagtgtggaacctcaagaagaagaaacaagcgcagcccaatgccaag
tggaaggcacacgatggtaacgtgactggactggacacgaactacttcggagacacgatc
atctcagctgctgtggatggaacgatcaaagtctgggagaagacaacgggtaataaatac
cctgtgtttgggctggcgatgtcgcccagctctgcccagttggcgtgcgtgttcattatc
cctcctgcgtcccgacccaatcgaaagtcacaggccgacgtctcttacagtcgagtatca
agctctcttgagtacattccgtcgccgtgggtgaaaaccccagaccagcttgtggacgtc
gtgtgcaggattctagacgagagtcagtcggtgagtagcttcatggatgtggtgtggttc
tgctataacgacaatgcagcggtcatgtcactcaacggatccacagacttggcaattcct
gccttgttgaacaagataaacggcgagccaagcgacagtgaagtactcgcacgtcagccg
atatatctacatctctgtgaagagctggagaagcgctactacgagtccacacaggcttcg
agctccacagcaaacggcggcaggcctcccattccactgtatctacaggcgtcgctgttg
ctgcgcagtgcaataacaccggcagagcaccaaatagccgctcaaaatgcagcgctggca
aagattcgacgcaccttgagtgtatactgggcggagcgctgcttaacggcgcttgtggcg
gcatctaagaaggcagaaaagtcacttcgagactatcttgaaagctccacgtctgagaag
accagcgcactggtgatggccgatttcctcagtgttcaagaccccttagcccaacgtagt
gaagcacttgttacgcacatctacgaccaactagattcgccggttcacgttgccacatgg
atcgcacacgtgaagacaaaggcgaacgcaagtactgaggaccagccagctgaagagcct
gctgtggccggtgcagtgtatacgccgccatcacgagaaacgtgcttcatttgcgagaag
agtgttccattcggagaacttgagattgtctgcgggtctggccatactctggagagatgc
ttcctctcattctgctgcatttcggccatggacgtgtggaagtgtatgggctgtggggtg
tcagcgtctgaaatcgacttgtccagtggcacatccccattttatttattggacttggag
gaacgtgacgacaaggaaatcgctactcccgctgcttcgaggatgaagatcatttgtcgt
ctgtgtggcagctactgtagcttctcgaaatattga

DBGET integrated database retrieval system