KEGG   Phytophthora infestans: PITG_12958Help
Entry
PITG_12958        CDS       T01333                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pif  Phytophthora infestans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pif00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PITG_12958
Enzymes [BR:pif01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PITG_12958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MSLKLYANLISQPSRSVAWVLKVKGVDHELVPVLPGSDFFKSDEFKALNPNRLVPAIKDD
DFVLTEGMAILQYLGDRYDWTGPKDLYPKDLKIRAKVNEFLHWHHTNTRLFTLNIVRPEI
AKKLNADSPKDQAALEGKDALIEKEFTLLETFLVNDFIANADFPTIADYTAYCEIDQLEL
MGYDFSKYPKVCAWIARMKTQPFNDEIHEPLKGFLKSFGLLA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaagctctacgccaacctcatcagccagccttcccgctctgtggcttgggta
ctcaaggtcaagggtgtcgaccatgaactcgtgccagtgctgccgggcagtgactttttc
aagtcggacgagttcaaggcactcaaccccaaccgactcgtgcctgccatcaaggacgac
gacttcgtgttgaccgagggcatggccatcttgcagtacctgggcgacagatacgactgg
acaggtcccaaggatctgtaccccaaggaccttaagatccgtgcgaaggtcaacgagttc
ttgcactggcaccacaccaacactcgtctctttacgttgaacatcgttcgaccggagatt
gctaagaaactcaacgctgactcgcctaaggaccaggcggcactggagggtaaagatgca
ctcattgagaaggaattcactctgcttgaaaccttcttggtcaacgatttcatcgcaaac
gccgacttccccacgatcgctgattacacagcttactgtgagatcgaccagcttgaactc
atgggctacgacttctccaagtaccccaaggtctgtgcctggatcgctcgcatgaagacc
cagccgtttaacgacgagatccacgaacctcttaagggatttttgaagagcttcggcctc
ctcgcctaa

DBGET integrated database retrieval system