KEGG   Psychromonas ingrahamii: Ping_2250Help
Entry
Ping_2250         CDS       T00450                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00020  Citrate cycle (TCA cycle)
pin00640  Propanoate metabolism
pin00660  C5-Branched dibasic acid metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Module
pin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ping_2250
   00640 Propanoate metabolism
    Ping_2250
   00660 C5-Branched dibasic acid metabolism
    Ping_2250
Enzymes [BR:pin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ping_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABM03991
JGI: Ping2250
UniProt: A1SWX6
Position
complement(2734243..2735409)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFREYGLPVPQGIACDTAEEAVSAASQIGGDKWVIKCQVHAGGRGKAGGV
ELVSTKDGLREFAHKWLGKNLVTFQTDANGQPVNKLLVESCSDIANELYLGAVIDRASQR
VTFMASTEGGVEIEKVAEETPELIHTAMIDPLVGAQAYQGRELAFKLGLSGKQIGQFTKI
FLGLATLFEEKDLSLLEINPLVVTAQDDLICLDGKISIDSNAMYRQKALHAINDTTQDDE
REMHAAQWELNYVALDGSIGCMVNGAGLAMGTMDIVHLHGGNPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGVIGAVAEVGVTVPVIVRLEGNNADLGRKI
LAESGLNIIAAASLTDAAEQAVKAVGGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcaggcaaaacagttgttcagagaatatggattacctgtacca
caaggtatcgcatgcgataccgctgaggaagcagtaagtgcagcctctcaaattggtgga
gacaaatgggttatcaagtgtcaggtacatgcaggtggccgtggtaaagccggtggtgtt
gagttagttagcactaaagatggtttacgtgagtttgcacataaatggttaggtaagaac
ttagttactttccaaaccgatgcaaacggtcaaccggttaataagttattagtagaaagc
tgtagtgatattgctaatgagctttacttaggtgcggttattgaccgtgcttcacaacgt
gttacttttatggcatcgacagaaggtggtgtagaaattgagaaagtagcagaagagacg
cctgagcttattcataccgcaatgattgatccattagtgggcgcacaagcgtaccaaggt
cgtgaacttgcctttaaattaggtctttctggtaaacagattggtcaatttacaaaaatc
tttctgggtcttgcgactctttttgaagagaaagatttatcgttattagaaatcaatcca
ctggttgtgactgcacaagacgatcttatctgtttagacggtaaaatttctatcgattct
aacgcaatgtaccgtcaaaaagcgttacatgcgataaacgatacaacgcaagatgatgaa
cgtgaaatgcatgctgcacaatgggaacttaactatgttgctcttgatggtagcatcggc
tgtatggtaaacggtgccggccttgcaatgggaacaatggatatcgtgcatttacacggt
ggtaatccggctaacttcctggacgtaggcggcggtgcaaccaaagaacgtgttaccgaa
gctttcaaaatcattctttctgacgataatgttaaagctgttttagtaaacatctttggc
ggtattgtacgttgtgatttaattgctgacggtgtcattggcgcagtagctgaagttggt
gtaacagtgcctgttatcgtgcgtttagaaggcaacaatgctgatttaggtcgtaaaatt
cttgcagaatctggtcttaatattatcgcagctgcatcattaacagatgctgctgagcaa
gcggttaaagcggtaggtggcaaataa

DBGET integrated database retrieval system