KEGG   Parvibaculum lavamentivorans: Plav_0258Help
Entry
Plav_0258         CDS       T00580                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pla  Parvibaculum lavamentivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plav_0258
DNA repair and recombination proteins [BR:pla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Plav_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
279953..280552
Genome map
AA seq 199 aa AA seqDB search
MAVTGPEIERLIALLSKLPGLGPRSARRAVLQLIKKKETLLGPLAAAMTDAMAKARICSA
CGNVDTQDPCAICADELRDPHILCIVEEVGDLWALERAGAHKGRYHVLGGVLSALDGVGP
DDLNIGRLVERLTGGEVREVVLAMNATVDGQTTAHYITDRISGLGISVSRLAHGVPVGGE
LDYLDDGTLAAAMKSRRPF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaccggtccggagatcgagcgcctgatcgcgctgctgtccaagctgcccggc
ctcggaccccgctccgcgcgccgcgcggtgctgcagctcatcaaaaagaaagaaacgctg
ctcgggccgctggcggccgccatgaccgatgccatggccaaggcgcggatttgctcggcc
tgcggcaatgtcgatacgcaggacccctgtgccatctgcgcggatgagctgcgcgacccg
catattctctgcatcgtcgaggaagtgggcgacctctgggcgctggagcgcgcgggggcg
cacaagggccgatatcatgtgctgggcggcgtgctctccgcgcttgatggcgtcgggccg
gacgatctcaatatcggcaggctggtcgagcggctgacgggtggcgaggtgcgcgaagtc
gttctcgccatgaatgcgacggtcgacggccagacgacggcgcattacatcaccgaccgg
atttccggcctcggcatctccgtctcgcggctggcacatggcgtgcctgtgggcggcgag
ctcgattatctcgatgacgggacgctggccgccgcgatgaaatcgcgacggcctttctga

DBGET integrated database retrieval system