KEGG   Pantoea ananatis LMG 5342: PANA5342_2323Help
Entry
PANA5342_2323     CDS       T01728                                 

Definition
xylose isomerase domain protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA5342_2323
   00051 Fructose and mannose metabolism
    PANA5342_2323
Enzymes [BR:plf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PANA5342_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2430781..2431761)
Genome map
AA seq 326 aa AA seqDB search
MSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSDSKT
LRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSRLMT
LWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNVTTC
LLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGLMAA
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQLNAN
PALAEAISRQDAVASQQIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggcacatctctac
tggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcaggcaaggtt
aaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgacagtaaaacg
ctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatgcggtgggat
gcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgccgtgaggcg
attgacctgaccaagcggggaatcgataccggacgggaatttggctcccgcttaatgacg
ttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaaaaaatctgg
gaagacgccgtcagcgcggtacgtgaaatcgccgactacgcgccggacgtggatgtgagc
attgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtgaccacctgc
ctgctggccgtcgaagaggccggaagcccgaatctcggcatcacgctggatttcgcccat
gtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgtcgttcccgg
ctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactgatggcggca
tcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgatggttatcag
ggcgcctactattttgacaccttcccggatgccagcggactggatccagtacgtgaagcc
gaaaccaacattgccaccgtgacgcgattactcaagctttgcgaccagcttaatgctaat
ccggcgctggcagaggcgatcagccgtcaggatgcggtcgcctcacagcaaatcgtcaac
gacattatgctggcgcgttaa

DBGET integrated database retrieval system