KEGG   Pantoea ananatis LMG 5342: PANA5342_2673Help
Entry
PANA5342_2673     CDS       T01728                                 

Gene name
glpK3
Definition
FGGY-like carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:plf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801666..2803153)
Genome map
AA seq 495 aa AA seqDB search
MHESVILAIDEGTTNAKAVAVNRQGKVVARASQGLTLQHPQPGLAEQAPMAIWLAVRQAI
ADCLAQCADAPVAAVAISNQRESVLIWQRRDGMPLTPLVSWQDRRSESFCRDLHLSGQAG
KITALTGLAVDPMFPAAKLTGMLASLPDGVARAAAGELCIGTVDSWLTWQLSAGECFVTD
HANAARTQLYSLHTNDWDDELLSLFSLPRAALPQITASAGCAGVVALTDIAGLAPGTPIL
ARIGDSHAALYAQRRDEAEVVKATYGTGSSLMMSMATPILTDNGLSTTVAWHDGQPRFAF
EGNITHTGSGAAWLGKMLGVTDPQQLTAMAESCDDNQGCYFVPALSGLGAPWWDLKARGM
LCGLTDAATPAVLARVALESITWQIADVFFAMEQASGDTLPALCVDGSATQNRWLMQFQA
DVLQRPLHCAPTAEASALGAALLAGKQLGWWQQGSDMQALKGGNVVMPRRQLAQKMQDSY
QGWLNAVARCRYQPA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagtccgtgattctggctattgatgaaggcaccaccaacgccaaagcggtcgcc
gtaaatcgtcagggaaaagtggtggcgcgggccagtcagggcctgacgctgcagcatccg
caacccggtctggccgagcaggcccccatggccatctggctggccgtcaggcaggcgata
gccgactgtcttgcccagtgcgccgacgcacccgtcgcggcggttgcgatcagcaatcag
cgtgaatcggttttgatatggcagcgccgggacggcatgccgctcaccccgctggtgagc
tggcaggaccgccgttcggaatcgttttgccgcgatcttcatctgtctggacaggccggg
aagattacggcgctaaccgggctggcggtcgatcctatgtttcctgccgccaagctgacc
ggcatgctggcgtcactgcctgacggcgttgccagagcggcggcgggggagttatgtatt
ggtacagtggacagctggctgacctggcaactgtcggcgggagagtgcttcgtcaccgac
catgccaatgcggcacgcacgcagctttacagtctgcacaccaacgactgggatgatgag
ctgctgtccctgttcagcctgccgcgcgccgcgctgccgcagattaccgcctcagcgggt
tgtgcgggcgtggttgccttaaccgatattgccggtctggcacctggcaccccgatcctg
gcacgcattggcgattcccatgcggcgctttatgcccagcgccgtgacgaggcggaagtg
gttaaggcaacctatggcacaggctcctcgctgatgatgtcgatggcaacgccgatcctg
accgacaatggcctcagcaccaccgtggcgtggcacgacggtcaaccgcgctttgcgttt
gaaggcaatattacccacaccggttcaggtgcggcctggctgggaaaaatgctcggcgtc
accgatccccagcagctgacggcaatggccgaaagctgtgatgacaatcagggctgctat
tttgtcccggccctgtccggactgggcgcgccctggtgggatttaaaagcccgcggcatg
ctgtgcggcctgaccgatgcggccaccccggcggtgctggcgcgggtcgcgctggagtcg
attacctggcaaattgctgatgtctttttcgctatggaacaggcaagcggcgacacatta
cctgcgctgtgcgttgacggcagtgcgacacaaaatcgctggctgatgcagtttcaggcg
gacgtcctgcagcgcccgctgcattgtgcgcctaccgctgaagcctccgcgctgggggcg
gcactgctggcaggtaaacagctgggatggtggcaacaggggagtgatatgcaggctctt
aagggcggcaacgtcgtgatgccgcgcaggcagctggcgcagaaaatgcaggacagctat
cagggctggctgaacgccgttgcccgctgtcgctatcagcccgcataa

DBGET integrated database retrieval system