KEGG   Pantoea ananatis LMG 5342: PANA5342_2673Help
Entry
PANA5342_2673     CDS       T01728                                 

Gene name
glpK3
Definition
FGGY-like carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PANA5342_2673 (glpK3)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PANA5342_2673 (glpK3)
Exosome [BR:plf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA5342_2673 (glpK3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801666..2803153)
Genome map
AA seq 495 aa AA seqDB search
MHESVILAIDEGTTNAKAVAVNRQGKVVARASQGLTLQHPQPGLAEQAPMAIWLAVRQAI
ADCLAQCADAPVAAVAISNQRESVLIWQRRDGMPLTPLVSWQDRRSESFCRDLHLSGQAG
KITALTGLAVDPMFPAAKLTGMLASLPDGVARAAAGELCIGTVDSWLTWQLSAGECFVTD
HANAARTQLYSLHTNDWDDELLSLFSLPRAALPQITASAGCAGVVALTDIAGLAPGTPIL
ARIGDSHAALYAQRRDEAEVVKATYGTGSSLMMSMATPILTDNGLSTTVAWHDGQPRFAF
EGNITHTGSGAAWLGKMLGVTDPQQLTAMAESCDDNQGCYFVPALSGLGAPWWDLKARGM
LCGLTDAATPAVLARVALESITWQIADVFFAMEQASGDTLPALCVDGSATQNRWLMQFQA
DVLQRPLHCAPTAEASALGAALLAGKQLGWWQQGSDMQALKGGNVVMPRRQLAQKMQDSY
QGWLNAVARCRYQPA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagtccgtgattctggctattgatgaaggcaccaccaacgccaaagcggtcgcc
gtaaatcgtcagggaaaagtggtggcgcgggccagtcagggcctgacgctgcagcatccg
caacccggtctggccgagcaggcccccatggccatctggctggccgtcaggcaggcgata
gccgactgtcttgcccagtgcgccgacgcacccgtcgcggcggttgcgatcagcaatcag
cgtgaatcggttttgatatggcagcgccgggacggcatgccgctcaccccgctggtgagc
tggcaggaccgccgttcggaatcgttttgccgcgatcttcatctgtctggacaggccggg
aagattacggcgctaaccgggctggcggtcgatcctatgtttcctgccgccaagctgacc
ggcatgctggcgtcactgcctgacggcgttgccagagcggcggcgggggagttatgtatt
ggtacagtggacagctggctgacctggcaactgtcggcgggagagtgcttcgtcaccgac
catgccaatgcggcacgcacgcagctttacagtctgcacaccaacgactgggatgatgag
ctgctgtccctgttcagcctgccgcgcgccgcgctgccgcagattaccgcctcagcgggt
tgtgcgggcgtggttgccttaaccgatattgccggtctggcacctggcaccccgatcctg
gcacgcattggcgattcccatgcggcgctttatgcccagcgccgtgacgaggcggaagtg
gttaaggcaacctatggcacaggctcctcgctgatgatgtcgatggcaacgccgatcctg
accgacaatggcctcagcaccaccgtggcgtggcacgacggtcaaccgcgctttgcgttt
gaaggcaatattacccacaccggttcaggtgcggcctggctgggaaaaatgctcggcgtc
accgatccccagcagctgacggcaatggccgaaagctgtgatgacaatcagggctgctat
tttgtcccggccctgtccggactgggcgcgccctggtgggatttaaaagcccgcggcatg
ctgtgcggcctgaccgatgcggccaccccggcggtgctggcgcgggtcgcgctggagtcg
attacctggcaaattgctgatgtctttttcgctatggaacaggcaagcggcgacacatta
cctgcgctgtgcgttgacggcagtgcgacacaaaatcgctggctgatgcagtttcaggcg
gacgtcctgcagcgcccgctgcattgtgcgcctaccgctgaagcctccgcgctgggggcg
gcactgctggcaggtaaacagctgggatggtggcaacaggggagtgatatgcaggctctt
aagggcggcaacgtcgtgatgccgcgcaggcagctggcgcagaaaatgcaggacagctat
cagggctggctgaacgccgttgcccgctgtcgctatcagcccgcataa

DBGET integrated database retrieval system