KEGG   Pelodictyon luteolum: Plut_0501Help
Entry
Plut_0501         CDS       T00291                                 

Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plut_0501
   01230 Biosynthesis of amino acids
    Plut_0501
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plut_0501
  Energy metabolism
   00680 Methane metabolism
    Plut_0501
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plut_0501
Enzymes [BR:plt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Plut_0501
Exosome [BR:plt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Plut_0501
  Exosomal proteins of melanoma cells
   Plut_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
586404..587147
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNLENRFTGWHDIDLTERGRKEAANAGKLIRAEGIVFDVAYTSVLKR
AIRTLWSVLDEMDQMWLPVHKSWRLNERHYGALQGLNKTETSQKYGEEQVLVWRRSYDTP
PPALGRDDERWPGADPRYRGMAEGEIPLSECLKDTVARFLPLWHETIAPQIRSGKSVAIV
AHGNSLRALVKYLDNISEDDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQDAVKQAVAA
VAGQAKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactggttttgttgcggcatggagagagtcagtggaaccttgaaaacagattc
accggctggcacgacatcgacctgacggaacgcggacgcaaagaggcggcaaacgccgga
aaactcatccgcgcagaaggtatcgtgttcgacgtggcctacacctccgtgctcaagcgt
gccatccgcaccctctggagcgtgctcgacgaaatggaccagatgtggctgccggtccac
aagagctggcggctcaacgaacgccactacggcgccctgcagggactcaacaaaaccgag
acttcgcagaagtacggcgaagagcaggtgctcgtgtggaggcgcagctacgatacgccg
cctcccgctctgggccgcgatgatgaacgctggccgggtgcagacccccgttaccgcggc
atggccgaaggggagatccccctcagcgagtgcctgaaggatacggtcgcccgtttcctc
cctctctggcacgagaccatcgctccccagatccggagcgggaagagtgtagccatcgtg
gcacacggcaactcgctgcgcgctctcgtcaagtatcttgacaacatctcagaagacgat
atcgtcggactgaacattcccaccggcatcccgcttgtctatgagctggacgatgacctg
aaaccgctgaagagttactacctcggggaccaggatgccgtgaagcaggcggtggccgcc
gtggccggtcaggcgaaagcctga

DBGET integrated database retrieval system