KEGG   Pelodictyon luteolum: Plut_0501Help
Entry
Plut_0501         CDS       T00291                                 

Definition
phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
plt  Pelodictyon luteolum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:plt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:plt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plt00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:plt00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:plt00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
586404..587147
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNLENRFTGWHDIDLTERGRKEAANAGKLIRAEGIVFDVAYTSVLKR
AIRTLWSVLDEMDQMWLPVHKSWRLNERHYGALQGLNKTETSQKYGEEQVLVWRRSYDTP
PPALGRDDERWPGADPRYRGMAEGEIPLSECLKDTVARFLPLWHETIAPQIRSGKSVAIV
AHGNSLRALVKYLDNISEDDIVGLNIPTGIPLVYELDDDLKPLKSYYLGDQDAVKQAVAA
VAGQAKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactggttttgttgcggcatggagagagtcagtggaaccttgaaaacagattc
accggctggcacgacatcgacctgacggaacgcggacgcaaagaggcggcaaacgccgga
aaactcatccgcgcagaaggtatcgtgttcgacgtggcctacacctccgtgctcaagcgt
gccatccgcaccctctggagcgtgctcgacgaaatggaccagatgtggctgccggtccac
aagagctggcggctcaacgaacgccactacggcgccctgcagggactcaacaaaaccgag
acttcgcagaagtacggcgaagagcaggtgctcgtgtggaggcgcagctacgatacgccg
cctcccgctctgggccgcgatgatgaacgctggccgggtgcagacccccgttaccgcggc
atggccgaaggggagatccccctcagcgagtgcctgaaggatacggtcgcccgtttcctc
cctctctggcacgagaccatcgctccccagatccggagcgggaagagtgtagccatcgtg
gcacacggcaactcgctgcgcgctctcgtcaagtatcttgacaacatctcagaagacgat
atcgtcggactgaacattcccaccggcatcccgcttgtctatgagctggacgatgacctg
aaaccgctgaagagttactacctcggggaccaggatgccgtgaagcaggcggtggccgcc
gtggccggtcaggcgaaagcctga

DBGET integrated database retrieval system