KEGG   Photorhabdus luminescens: plu4619Help
Entry
plu4619           CDS       T00149                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
plu  Photorhabdus luminescens
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:plu00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(5382246..5383244)
Genome map
AA seq 332 aa AA seqDB search
MTPEMLKESWFNREVQFSVFANGPLLDFWQAREECEFIGVDNVLIRYVRFCTTIKNDRAV
VIFPGRSESYVKYSEVAFDFYHLGYDIFIIDHRGQGRSSRILADPQKGHVEKFDDYIDDV
EILIEREILPRHYSHCYALAHSMGAAILGGFLLRHSQVFDAAALCAPMFGINFPMPRWLA
TFLVNRAEKRPDMRNHYAVFTGKWRPLPYLINLLTHSYERYSRYLRYYADYPELHIGGPT
YRWVRESIWIGDMLIEKAGEIETPLIILKASEDKVVNNCRLRAFCESRNKVRAFIKERSP
LIIQGAHHEILFEKDKLRSQALNAICDFFDQN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacgccagaaatgttgaaagaaagttggttcaatcgtgaggtgcagttctctgttttt
gccaatgggcctctgttagatttttggcaagctagggaagagtgtgaatttatcggcgtc
gataatgtactgatacgttatgttcgtttttgcacaacaataaaaaatgatagagcggtt
gttatctttcctggccgtagtgaaagttatgtcaaatactcggaagtagcatttgatttt
tatcaccttggttacgacatttttattattgatcatcgtgggcaggggcgatccagcagg
atacttgcagatccacaaaaagggcatgtagaaaaatttgatgattatattgatgacgtt
gaaatattaatagaaagagaaattcttcctcgtcattattctcattgttatgcgttagct
cattcaatgggagcggcaatattagggggatttttattacgtcacagccaggtatttgat
gcagcagccctttgtgctcctatgtttggtattaactttcctatgccacgttggttggca
actttcctggtaaatcgggctgaaaagcggccggatatgcgcaaccattatgcggtattt
actgggaaatggcgtccgttgccttatttgataaaccttctgacacacagttatgaacgt
tatagccgttacctccgttattacgcggattatccggaattacatatcgggggaccgaca
tatcgttgggtgcgggaaagtatctggattggcgatatgctgatagaaaaagccggagaa
attgagacgccattgataattttaaaagccagtgaagataaggttgttaataattgccga
ttacgggctttttgtgaatcacgtaataaagtgagggctttcatcaaagaacgttcacct
ttgattattcaaggggcgcatcatgagatcctgtttgaaaaagataaattacgtagccag
gcactcaacgccatttgtgatttttttgaccagaattga

DBGET integrated database retrieval system